Plant FIBer expression Database

Potri.001G186400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G186400.1 pacid=42793516 polypeptide=Potri.001G186400.1.p locus=Potri.001G186400 ID=Potri.001G186400.1.v4.1 annot-version=v4.1
ATGGTATGCATAGGAATTATATTTGGGTGCAAACATTCCCGCTCCATCAAAGACTATGTTCTGTCAGCTTTGGTGATTGTAACCATACTTATTTGTTTGC
GCATATTTTGTTATGCTATTTATCGGTTGTTGAAGAAGGAGCAACCGCGACATGGTGAGGATCGGAGGGGTGGATTGGAAATGCAGCCAGAGAATGCAAG
CCATGCTCACCGGATTTGCACATGCAGAGCATTGCTAGAGAGCAACTTTGTGAGCTCAGCAGAAGATGGAGTTGCTTCTTTTGTTGTTCAACACAATTAA
AA sequence
>Potri.001G186400.1 pacid=42793516 polypeptide=Potri.001G186400.1.p locus=Potri.001G186400 ID=Potri.001G186400.1.v4.1 annot-version=v4.1
MVCIGIIFGCKHSRSIKDYVLSALVIVTILICLRIFCYAIYRLLKKEQPRHGEDRRGGLEMQPENASHAHRICTCRALLESNFVSSAEDGVASFVVQHN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G186400
[exp]
0 1
AT5G19300 unknown protein Potri.010G091400
[exp]
15.81 0.8366
AT5G20930 TSL TOUSLED, Protein kinase superf... Potri.004G193300
[exp]
17.02 0.8600
AT4G18465 RNA helicase family protein (.... Potri.004G052700
[exp]
21.42 0.8540
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Potri.010G205550
[exp]
27.34 0.8387
AT1G34150 Pseudouridine synthase family ... Potri.002G061650
[exp]
27.74 0.8516
AT2G02250 ATPP2-B2 phloem protein 2-B2 (.1) Potri.018G016000
[exp]
28.46 0.8581
AT3G14460 LRR and NB-ARC domains-contain... Potri.017G015000
[exp]
28.61 0.8484
AT5G51290 Diacylglycerol kinase family p... Potri.004G233300
[exp]
29.39 0.8430
AT3G14610 CYP72A7 "cytochrome P450, family 72, s... Potri.005G126600
[exp]
30.82 0.8528
AT3G14470 NB-ARC domain-containing disea... Potri.003G200500
[exp]
31.93 0.8467

Potri.001G186400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.