Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	TIP2.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G16240 372 / 8e-132 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT5G47450 326 / 1e-113 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT4G17340 310 / 3e-107 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT2G36830 289 / 6e-99 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT3G26520 276 / 9e-94 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT4G01470 256 / 3e-86 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT2G25810 223 / 6e-73 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT1G73190 218 / 1e-70 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT1G17810 213 / 6e-69 BETA-TIP beta-tonoplast intrinsic protein (.1) AT3G47440 200 / 5e-64 TIP5;1 tonoplast intrinsic protein 5;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G050900 [exp] 416 / 5e-149 AT3G16240 311 / 5e-108 delta tonoplast integral protein (.1) Potri.003G077800 [exp] 326 / 1e-113 AT4G17340 351 / 2e-123 tonoplast intrinsic protein 2;2 (.1) Potri.001G157000 [exp] 309 / 4e-107 AT4G17340 333 / 3e-116 tonoplast intrinsic protein 2;2 (.1) Potri.004G216500 [exp] 275 / 3e-93 AT4G01470 331 / 2e-115 tonoplast intrinsic protein 1;3 (.1) Potri.009G005400 [exp] 270 / 1e-91 AT2G36830 355 / 7e-125 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.010G209900 [exp] 258 / 5e-87 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.008G050700 [exp] 254 / 2e-85 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.009G027200 [exp] 248 / 8e-83 AT4G01470 367 / 7e-130 tonoplast intrinsic protein 1;3 (.1) Potri.006G121700 [exp] 247 / 2e-82 AT2G36830 345 / 6e-121 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038293 [exp] 379 / 9e-135 AT3G16240 396 / 2e-141 delta tonoplast integral protein (.1) Lus10025808 [exp] 372 / 1e-131 AT3G16240 389 / 2e-138 delta tonoplast integral protein (.1) Lus10007796 [exp] 324 / 1e-112 AT5G47450 389 / 1e-138 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10004733 [exp] 323 / 2e-112 AT5G47450 393 / 4e-140 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10022611 [exp] 268 / 1e-90 AT2G36830 403 / 5e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10021510 [exp] 268 / 2e-90 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10005885 [exp] 252 / 2e-84 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1) Lus10023913 [exp] 252 / 2e-84 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10040863 [exp] 249 / 2e-83 AT4G01470 394 / 2e-140 tonoplast intrinsic protein 1;3 (.1) Lus10003288 [exp] 249 / 3e-83 AT4G01470 388 / 6e-138 tonoplast intrinsic protein 1;3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [poplar] [flax] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Potri.001G186700.1 pacid=42792509 polypeptide=Potri.001G186700.1.p locus=Potri.001G186700 ID=Potri.001G186700.1.v4.1 annot-version=v4.1 ATGGCTGGAATTGCCTTTGGTCGCTTTGATGATTCTTTCAGTTTAGGGTCTTTTAAGGCCTATCTTGCTGAATTCATCTCAACTTTGCTCTTTGTTTTTG CTGGTGTTGGTTCAGCCATGGCTTACAATAAGCTGACAGGTGATGCAGCTCTTGATCCTGCTGGGCTAGTAGCCATTGCGGTTTGCCATGGATTTGCTCT CTTCGTTGCAGTTTCTGTAGGTGCCAACATCTCCGGTGGCCATGTTAACCCTGCTGTCACTTTTGGCTTGGCTCTTGGTGGCCAAATCACCATCCTCACT GGCATCTTCTACTGGATTGCCCAGCTCCTGGGCTCCATTGTTGCATGCTACCTTCTCAAAGTTGCCACTGGAGGCTTGGCAGTCCCCATCCACAGTGTTG CAGCTGGAGTAGGAGCCATTGAAGGAGTCGTCATGGAGATCATCATCACATTTGCCTTGGTTTACACTGTCTATGCAACTGCTGCTGACCCCAAGAAGGG ATCCCTCGGCACCATAGCTCCCATAGCCATCGGTTTCATTGTGGGTGCCAACATCTTGGCTGCAGGCCCATTCTCTGGTGGATCCATGAACCCAGCCCGA TCATTTGGCCCAGCTGTGGCTAGTGGTGATTTCCATGACAACTGGATCTACTGGGCTGGGCCTCTTGTTGGTGGTGGGATTGCTGGACTTATCTATGGAA ACGTGTTCATCACTGATCATACTCCTTTGTCCGGAGACTTCTAA
AA sequence Show only first row Show all	>Potri.001G186700.1 pacid=42792509 polypeptide=Potri.001G186700.1.p locus=Potri.001G186700 ID=Potri.001G186700.1.v4.1 annot-version=v4.1 MAGIAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAMAYNKLTGDAALDPAGLVAIAVCHGFALFVAVSVGANISGGHVNPAVTFGLALGGQITILT GIFYWIAQLLGSIVACYLLKVATGGLAVPIHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPAR SFGPAVASGDFHDNWIYWAGPLVGGGIAGLIYGNVFITDHTPLSGDF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G16240		DELTA-TIP1, ATT...	delta tonoplast integral prote...		Potri.001G186700 [exp]	0	1	TIP2.4
AT1G11915			unknown protein		Potri.011G007900 [exp]	2.00	0.8750
AT5G56540		ATAGP14, AGP14	arabinogalactan protein 14 (.1...		Potri.019G035500 [exp]	6.16	0.8263
AT4G28980		CAK1AT, CDKF;1	CYCLIN-DEPENDENT KINASE F;1, C...		Potri.018G083300 [exp]	6.32	0.8701	Pt-CAK1.2
AT5G55650			unknown protein		Potri.001G367100 [exp]	7.93	0.8446
AT3G28917	ZF_HD	MIF2	mini zinc finger 2 (.1)		Potri.017G082701 [exp]	8.36	0.7958
AT1G60790		TBL2	TRICHOME BIREFRINGENCE-LIKE 2,...		Potri.010G043300 [exp]	9.32	0.8645
AT5G19180		ECR1	E1 C-terminal related 1 (.1)		Potri.008G204000 [exp]	12.16	0.8600	Pt-ECR1.1
AT3G13980			unknown protein		Potri.006G144700 [exp]	16.58	0.8379
AT1G46480	HD	WOX4	WUSCHEL related homeobox 4 (.1...		Potri.002G124100 [exp]	18.97	0.8436
AT5G14390			alpha/beta-Hydrolases superfam...		Potri.001G340000 [exp]	21.21	0.8340

Compare expression of checked genes

Potri.001G186700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.