Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19210 116 / 4e-32 Leucine-rich repeat transmembrane protein kinase protein (.1) AT1G51880 112 / 1e-30 RHS6 root hair specific 6 (.1) AT1G51890 112 / 2e-30 Leucine-rich repeat protein kinase family protein (.1.2) AT1G51870 108 / 3e-29 protein kinase family protein (.1) AT1G51850 107 / 1e-28 Leucine-rich repeat protein kinase family protein (.1) AT2G19230 107 / 1e-28 Leucine-rich repeat transmembrane protein kinase protein (.1) AT1G51860 106 / 2e-28 Leucine-rich repeat protein kinase family protein (.1) AT4G29990 106 / 2e-28 Leucine-rich repeat transmembrane protein kinase protein (.1) AT5G16900 106 / 2e-28 Leucine-rich repeat protein kinase family protein (.1) AT2G04300 105 / 3e-28 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G094600 [exp] 94 / 6e-24 AT4G29990 636 / 0.0 Leucine-rich repeat transmembrane protein kinase protein (.1) Potri.019G094300 [exp] 92 / 1e-23 AT4G29990 628 / 0.0 Leucine-rich repeat transmembrane protein kinase protein (.1) Potri.019G094200 [exp] 89 / 2e-22 AT4G29990 452 / 1e-150 Leucine-rich repeat transmembrane protein kinase protein (.1) Potri.019G094700 [exp] 89 / 4e-22 AT4G29990 652 / 0.0 Leucine-rich repeat transmembrane protein kinase protein (.1) Potri.003G053301 [exp] 74 / 3e-17 AT1G52290 531 / 0.0 proline-rich extensin-like receptor kinase 15, Protein kinase superfamily protein (.1) Potri.004G153600 [exp] 74 / 4e-17 AT4G34440 551 / 0.0 proline-rich extensin-like receptor kinase 5, Protein kinase superfamily protein (.1) Potri.011G131200 [exp] 74 / 6e-17 AT5G54590 631 / 0.0 calcium/calmodulin-regulated receptor-like kinase 1, Protein kinase superfamily protein (.1.2) Potri.008G111600 [exp] 73 / 8e-17 AT1G68690 622 / 0.0 proline-rich extensin-like receptor kinase 9, Protein kinase superfamily protein (.1) Potri.009G115200 [exp] 73 / 9e-17 AT4G34440 575 / 0.0 proline-rich extensin-like receptor kinase 5, Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025849 [exp] 95 / 3e-24 AT4G29990 803 / 0.0 Leucine-rich repeat transmembrane protein kinase protein (.1) Lus10020452 [exp] 75 / 4e-17 AT5G10530 510 / 2e-173 Concanavalin A-like lectin protein kinase family protein (.1) Lus10011917 [exp] 74 / 4e-17 AT2G20300 951 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Lus10007077 [exp] 74 / 5e-17 AT5G10530 511 / 4e-171 Concanavalin A-like lectin protein kinase family protein (.1) Lus10022848 [exp] 74 / 5e-17 AT2G20300 912 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Lus10022129 [exp] 73 / 1e-16 AT3G24550 474 / 3e-159 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1) Lus10027635 [exp] 73 / 1e-16 AT5G56890 887 / 0.0 Protein kinase superfamily protein (.1) Lus10011098 [exp] 73 / 2e-16 AT3G24550 700 / 0.0 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1) Lus10023645 [exp] 72 / 2e-16 AT3G24550 691 / 0.0 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1) Lus10017898 [exp] 72 / 3e-16 AT1G68690 631 / 0.0 proline-rich extensin-like receptor kinase 9, Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.001G191701.1 pacid=42793567 polypeptide=Potri.001G191701.1.p locus=Potri.001G191701 ID=Potri.001G191701.1.v4.1 annot-version=v4.1 ATGACCAACTTCGGAAGAATTCTCGGTAAGGGAGGATTTGGGACAGTTAACCATGGCTACTTGAATGATACTCAAGCAGCTGTCAAGATGTTGACTCCAT CATCGGTTCAAGGGTACAAGGAGTTTGAGGCAGAGGTTAAACTTTTTTTGAGAGTGCATCATAGAAACTTGACTAATCTTGTTGGGTACTGCCATGAAGG CACCAAAATGGGTCTTGTGTATGTACGTACCTGGCTAATGAAAATTTGA
AA sequence Show only first row Show all	>Potri.001G191701.1 pacid=42793567 polypeptide=Potri.001G191701.1.p locus=Potri.001G191701 ID=Potri.001G191701.1.v4.1 annot-version=v4.1 MTNFGRILGKGGFGTVNHGYLNDTQAAVKMLTPSSVQGYKEFEAEVKLFLRVHHRNLTNLVGYCHEGTKMGLVYVRTWLMKI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G19210			Leucine-rich repeat transmembr...		Potri.001G191701 [exp]	0	1
AT1G37140		MCT1	MEI2 C-terminal RRM only like ...		Potri.002G088200 [exp]	4.35	0.9207
					Potri.001G459001 [exp]	6.78	0.9140
AT1G23420	YABBY	INO, YAB4	INNER NO OUTER, Plant-specific...		Potri.010G042400 [exp]	10.00	0.9111	Pt-INO.2
AT1G04645			Plant self-incompatibility pro...		Potri.018G148366 [exp]	14.49	0.9033
AT2G46950		CYP709B2	"cytochrome P450, family 709, ...		Potri.006G022200 [exp]	14.69	0.9078	Pt-CYP709.2
AT1G75490	AP2_ERF	DREB2D	Integrase-type DNA-binding sup...		Potri.002G029400 [exp]	15.19	0.9005
AT2G33640			DHHC-type zinc finger family p...		Potri.005G254366 [exp]	16.15	0.6840
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Potri.010G111400 [exp]	19.28	0.8910
AT5G01600		ATFER1	ARABIDOPSIS THALIANA FERRETIN ...		Potri.006G103900 [exp]	19.74	0.8894
AT1G75490	AP2_ERF	DREB2D	Integrase-type DNA-binding sup...		Potri.005G233300 [exp]	19.97	0.8651

Compare expression of checked genes

Potri.001G191701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.