Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15370 263 / 8e-92 SNARE-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G253700 [exp] 203 / 2e-68 AT1G15370 197 / 4e-66 SNARE-like superfamily protein (.1) Potri.003G043200 [exp] 39 / 0.0006 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002016 [exp] 246 / 2e-85 AT1G15370 253 / 7e-88 SNARE-like superfamily protein (.1) Lus10002911 [exp] 246 / 2e-85 AT1G15370 253 / 7e-88 SNARE-like superfamily protein (.1) Lus10037624 [exp] 39 / 0.0005 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1) Lus10006883 [exp] 39 / 0.0005 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF01217 [poplar] [flax] Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence Show only first row Show all	>Potri.001G193100.2 pacid=42789912 polypeptide=Potri.001G193100.2.p locus=Potri.001G193100 ID=Potri.001G193100.2.v4.1 annot-version=v4.1 ATGATCCTTGCAGTATTGTTCGCAAATGTTGAAGGCAACATCTTAATCGAACGGTTTAGTGGAGTTCCAGCTGAGGAACGGCTGCATTGGAGATCTTTCT TGGTTAAGCTGGGGGCAGATAATCTAAAAGGTGTTAGAAACGAGGAGCTCCTTGTTGCTTCTCACAAGTCAGTTTATATTGTTTACACAGTGCTTGGGGA TGTCAGCATTTTCATTGTTGGCAAAGATGAGTATGATGAACTTGCGTTGACAGAAGTCATCTTCGCCATAACATCAGCTTTAAAGGATGTATGTGGGAAG CCCCCTACGGAGCGCCTCTTCCTCGACAAGTACGGAAAGATATGCTTGTGCCTGGATGAAATTGTTTGGAAGGGACTGCTGGAGAACACAGACAAAGAAA GAGTTAGAAGGCTAACAAGATTAAAACCTCCAACAGAGTTCTGA
AA sequence Show only first row Show all	>Potri.001G193100.2 pacid=42789912 polypeptide=Potri.001G193100.2.p locus=Potri.001G193100 ID=Potri.001G193100.2.v4.1 annot-version=v4.1 MILAVLFANVEGNILIERFSGVPAEERLHWRSFLVKLGADNLKGVRNEELLVASHKSVYIVYTVLGDVSIFIVGKDEYDELALTEVIFAITSALKDVCGK PPTERLFLDKYGKICLCLDEIVWKGLLENTDKERVRRLTRLKPPTEF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15370			SNARE-like superfamily protein...		Potri.001G193100 [exp]	0	1
					Potri.001G022601 [exp]	2.00	0.9252
AT2G21870		MGP1	MALE GAMETOPHYTE DEFECTIVE 1, ...		Potri.005G085500 [exp]	2.64	0.9314
AT1G74690		IQD31	IQ-domain 31 (.1)		Potri.015G063600 [exp]	5.47	0.9253
					Potri.016G091300 [exp]	6.00	0.9088
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Potri.018G145544 [exp]	6.92	0.9065
AT3G02790	C2H2ZnF		zinc finger (C2H2 type) family...		Potri.019G053500 [exp]	7.34	0.9059
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Potri.006G187700 [exp]	8.71	0.9053
AT1G34350			unknown protein		Potri.013G114800 [exp]	9.16	0.9180
AT5G45420	MYB	maMYB	membrane anchored MYB, Duplica...		Potri.001G147000 [exp]	10.09	0.9063
AT3G13410			unknown protein		Potri.008G223987 [exp]	10.95	0.9106

Compare expression of checked genes

Potri.001G193100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.