Potri.001G194100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009731 76 / 2e-19 ND /
Lus10000527 74 / 2e-18 ND /
PFAM info
Representative CDS sequence
>Potri.001G194100.3 pacid=42791039 polypeptide=Potri.001G194100.3.p locus=Potri.001G194100 ID=Potri.001G194100.3.v4.1 annot-version=v4.1
ATGTCTATTAAGAAAACTCTTTCACTAACCAGCAAAGCCGTTAAGGACGATCAGGTCTCGGAAAAACGCAGGCGGTCTGATCGATGCTTTTCATTCAAGG
AGATATCGATAGAACCAGGAAAATCACTAAAAGACCTGGATTCAAACAAGTTCAAGATTGATATCAAGAGATGGGCCAGGGCTGTTGTGGCATATGCACG
CCAAGTAAGTAGCAGGTTTGGAAGCGCTAGAAAAAGTGGCCGGATTGGAAGCTCTCGTGATTCATCACAGGACTCCATATAG
AA sequence
>Potri.001G194100.3 pacid=42791039 polypeptide=Potri.001G194100.3.p locus=Potri.001G194100 ID=Potri.001G194100.3.v4.1 annot-version=v4.1
MSIKKTLSLTSKAVKDDQVSEKRRRSDRCFSFKEISIEPGKSLKDLDSNKFKIDIKRWARAVVAYARQVSSRFGSARKSGRIGSSRDSSQDSI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G194100 0 1
AT5G13080 WRKY ATWRKY75, WRKY7... ARABIDOPSIS THALIANA WRKY DNA-... Potri.001G058800 1.00 0.9914
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.008G213100 4.89 0.9854
Potri.010G075100 9.53 0.9855
AT3G49780 ATPSK3(FORMERSY... phytosulfokine 4 precursor (.1... Potri.009G085600 13.52 0.9656
AT4G14746 unknown protein Potri.013G039300 14.42 0.9887 Pt-MTN26.2
AT1G17860 Kunitz family trypsin and prot... Potri.001G309900 14.83 0.9842
AT3G21790 UDP-Glycosyltransferase superf... Potri.016G016100 15.29 0.9795
AT1G58420 Uncharacterised conserved prot... Potri.014G014500 17.37 0.9709
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Potri.003G099000 20.00 0.9825
AT2G03550 alpha/beta-Hydrolases superfam... Potri.009G104100 20.78 0.9840

Potri.001G194100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.