Potri.001G197200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G08520 286 / 3e-100 SNARE-like superfamily protein (.1)
AT3G09800 286 / 3e-100 SNARE-like superfamily protein (.1)
AT1G60970 283 / 6e-99 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G043200 351 / 6e-126 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1)
Potri.001G352900 257 / 1e-88 AT1G60970 278 / 6e-97 SNARE-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037624 325 / 2e-115 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10006883 325 / 2e-115 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10025383 242 / 1e-82 AT1G60970 235 / 6e-80 SNARE-like superfamily protein (.1)
Lus10015263 56 / 4e-11 AT1G60970 55 / 4e-11 SNARE-like superfamily protein (.1)
Lus10012924 40 / 0.0002 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Potri.001G197200.1 pacid=42790971 polypeptide=Potri.001G197200.1.p locus=Potri.001G197200 ID=Potri.001G197200.1.v4.1 annot-version=v4.1
ATGGATTCCTGCCCCGTGGTGAAAAACATTCTTCTGCTAGACTCTGAAGGGAAGCGAGTTGCGGTCAAATACTATTCAGATGACTGGCCGACCAATAATG
CAAAGTTAGCTTTTGAAAAATTGCTTTTTGCAAAGACTATGAAATCAAATGCCCGCACAGAAGCGGAGATTACAATGTTTGACAGTAACATTGTCATCTA
CAAATGTGTCCAGGACCTCCATTTTTATGTGACTGGAGGTGAGGATGAAAATGAACTCATTTTAGCTGCTGTTCTTCAGGGTTTCTTTGATTCAGTCTCT
CTTCTCTTGAGGAGCAATGTCGACAAAAGGGAGGCACTTGAAAACTTAGATCTCATTTTCTTATGCCTTGATGAGATTGTTGAAAGAGGCATGATCCTCG
AAACAGATGCCAATGTTATTGCTGGAAAGGTGGCTGTAAATAGCATGGATCCTAGTGCACCTCTATCCGAGCAGACAATAGGTCAAGCATTGGCCACAGC
TCGTGAACACTTGACGAGAACCCTTTTTCAGTAG
AA sequence
>Potri.001G197200.1 pacid=42790971 polypeptide=Potri.001G197200.1.p locus=Potri.001G197200 ID=Potri.001G197200.1.v4.1 annot-version=v4.1
MDSCPVVKNILLLDSEGKRVAVKYYSDDWPTNNAKLAFEKLLFAKTMKSNARTEAEITMFDSNIVIYKCVQDLHFYVTGGEDENELILAAVLQGFFDSVS
LLLRSNVDKREALENLDLIFLCLDEIVERGMILETDANVIAGKVAVNSMDPSAPLSEQTIGQALATAREHLTRTLFQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G09800 SNARE-like superfamily protein... Potri.001G197200 0 1
AT4G02580 NADH-ubiquinone oxidoreductase... Potri.005G218000 1.41 0.9633
AT1G09330 ECHIDNA, ECH unknown protein Potri.005G010400 1.73 0.9638
AT5G59410 Rab5-interacting family protei... Potri.009G032100 2.00 0.9534
AT3G55440 CYTOTPI, ATCTIM... CYTOSOLIC ISOFORM TRIOSE PHOSP... Potri.009G031200 2.44 0.9584
AT4G35335 Nucleotide-sugar transporter f... Potri.016G113200 3.00 0.9427
AT3G49720 unknown protein Potri.009G082400 3.74 0.9438
AT4G17486 PPPDE putative thiol peptidase... Potri.006G154400 4.24 0.9461
AT4G29340 PRF4 profilin 4 (.1) Potri.006G235200 4.47 0.9479 Pt-PRO1.4
AT2G45140 PVA12 plant VAP homolog 12 (.1) Potri.001G152000 5.47 0.9425
AT4G00560 NAD(P)-binding Rossmann-fold s... Potri.014G079700 5.65 0.9436

Potri.001G197200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.