Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17550 158 / 7e-46 HAB2 homology to ABI2 (.1) AT1G72770 144 / 1e-41 HAB1 HYPERSENSITIVE TO ABA1, homology to ABI1 (.1.2.3) AT5G57050 113 / 7e-30 AtABI2, ABI2 ABA INSENSITIVE 2, Protein phosphatase 2C family protein (.1.2) AT4G26080 99 / 2e-24 AtABI1, ABI1 ABA INSENSITIVE 1, Protein phosphatase 2C family protein (.1) AT2G29380 62 / 1e-11 HAI3 highly ABA-induced PP2C gene 3 (.1) AT3G11410 56 / 2e-09 ATPP2CA, AHG3 ARABIDOPSIS THALIANA PROTEIN PHOSPHATASE 2CA, protein phosphatase 2CA (.1) AT1G07430 56 / 2e-09 HAI2 highly ABA-induced PP2C gene 2 (.1) AT5G59220 54 / 1e-08 SAG113, HAI1 senescence associated gene 113, highly ABA-induced PP2C gene 1 (.1) AT1G17545 47 / 1e-06 Protein phosphatase 2C family protein (.1) AT5G51760 45 / 9e-06 AHG1 ABA-hypersensitive germination 1, Protein phosphatase 2C family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G044200 [exp] 254 / 2e-82 AT1G72770 576 / 0.0 HYPERSENSITIVE TO ABA1, homology to ABI1 (.1.2.3) Potri.006G224600 [exp] 167 / 4e-49 AT1G72770 503 / 1e-174 HYPERSENSITIVE TO ABA1, homology to ABI1 (.1.2.3) Potri.018G060300 [exp] 159 / 3e-46 AT1G72770 493 / 8e-171 HYPERSENSITIVE TO ABA1, homology to ABI1 (.1.2.3) Potri.006G164632 [exp] 76 / 2e-16 AT4G26080 300 / 1e-98 ABA INSENSITIVE 1, Protein phosphatase 2C family protein (.1) Potri.008G059200 [exp] 61 / 5e-11 AT1G07430 362 / 1e-122 highly ABA-induced PP2C gene 2 (.1) Potri.010G199600 [exp] 59 / 4e-10 AT3G11410 386 / 9e-133 ARABIDOPSIS THALIANA PROTEIN PHOSPHATASE 2CA, protein phosphatase 2CA (.1) Potri.001G245200 [exp] 58 / 7e-10 AT2G29380 410 / 5e-142 highly ABA-induced PP2C gene 3 (.1) Potri.001G092100 [exp] 55 / 5e-09 AT1G07430 219 / 3e-67 highly ABA-induced PP2C gene 2 (.1) Potri.015G018800 [exp] 52 / 7e-08 AT1G07430 236 / 2e-74 highly ABA-induced PP2C gene 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025000 [exp] 158 / 8e-46 AT1G72770 467 / 1e-160 HYPERSENSITIVE TO ABA1, homology to ABI1 (.1.2.3) Lus10026447 [exp] 157 / 2e-45 AT1G72770 465 / 1e-159 HYPERSENSITIVE TO ABA1, homology to ABI1 (.1.2.3) Lus10012962 [exp] 76 / 3e-16 AT4G26080 315 / 2e-104 ABA INSENSITIVE 1, Protein phosphatase 2C family protein (.1) Lus10016493 [exp] 59 / 2e-10 AT1G07430 421 / 2e-145 highly ABA-induced PP2C gene 2 (.1) Lus10040738 [exp] 57 / 1e-09 AT1G07430 429 / 7e-148 highly ABA-induced PP2C gene 2 (.1) Lus10004703 [exp] 56 / 5e-09 AT2G29380 392 / 3e-135 highly ABA-induced PP2C gene 3 (.1) Lus10040270 [exp] 51 / 1e-07 AT2G29380 390 / 1e-134 highly ABA-induced PP2C gene 3 (.1) Lus10003887 [exp] 42 / 0.0001 AT2G29380 144 / 1e-39 highly ABA-induced PP2C gene 3 (.1) Lus10003399 [exp] 42 / 0.0002 AT2G29380 252 / 2e-82 highly ABA-induced PP2C gene 3 (.1) Lus10003423 [exp] 40 / 0.0005 AT4G31860 612 / 0.0 Protein phosphatase 2C family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G198501.3 pacid=42789934 polypeptide=Potri.001G198501.3.p locus=Potri.001G198501 ID=Potri.001G198501.3.v4.1 annot-version=v4.1 ATGCAGAAATCTATGATGGATCTGACATTAAGGCATCGGCTGTGTTTCTTAAATTTTCTAGTAAGAAGAATCTCATTGGAGGACCTACACGGAGTGTTTT TGAGCTTGATCGTGTTCCTCTATGGGGTTCTGTATCTATGTGTAAGAAGATTGGAAATGGAAGATGCTGTTGCAGCTTTTCCTCGATTTGCAAAAGTTCC TATCAAGATGCTTATTGGTGATCGTGTTGTTGATGGCATCAGTGAGAGTTTGACCCACCTGACCAGTCATTTTTTTGGTGTTTACGATGGCCATGGGGGT GCACAGGTTGCTAATTATTGTGATCAAATCCATTTGGCCTTGGCTGAAGAGGTTGAAAACATTAAAAACAATTCGAATGTTGGGATTATTTGGGGAAATC AGCAGGTGCAATGGGAGAAAGCCTTCACTAGTTGCTATCATAAGGTTGATGACGAGATTGGAGGAAAGAGCGTTAGAGGCATCATCAAAGGTGATGAAAA TGCTTCTATTGCCAGATTTGAACCTGTAGCACCAGAAACAGTTGGATCTACAGCTGGGTATCGTTGGTCTGTTCGTCCCACATCATAG
AA sequence Show only first row Show all	>Potri.001G198501.3 pacid=42789934 polypeptide=Potri.001G198501.3.p locus=Potri.001G198501 ID=Potri.001G198501.3.v4.1 annot-version=v4.1 MQKSMMDLTLRHRLCFLNFLVRRISLEDLHGVFLSLIVFLYGVLYLCVRRLEMEDAVAAFPRFAKVPIKMLIGDRVVDGISESLTHLTSHFFGVYDGHGG AQVANYCDQIHLALAEEVENIKNNSNVGIIWGNQQVQWEKAFTSCYHKVDDEIGGKSVRGIIKGDENASIARFEPVAPETVGSTAGYRWSVRPTS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17550		HAB2	homology to ABI2 (.1)		Potri.001G198501 [exp]	0	1
AT4G02030			Vps51/Vps67 family (components...		Potri.014G120900 [exp]	8.00	0.6951
AT5G51230	C2H2ZnF	AtEMF2, CYR1, V...	CYTOKININ RESISTANT 1, EMBRYON...		Potri.001G080200 [exp]	14.93	0.7359	VEF901,Pt-VRN2.5
AT1G30410		ATMRP13, ABCC12	ATP-binding cassette C12, mult...		Potri.011G043100 [exp]	18.49	0.6854	Pt-ATMRP12.3
AT1G10760		GWD1, GWD, SOP1...	STARCH EXCESS 1, Pyruvate phos...		Potri.008G188150 [exp]	27.11	0.6813
AT4G38180	FAR1_related	FRS5	FAR1-related sequence 5 (.1)		Potri.017G091000 [exp]	35.49	0.6245
AT1G43850		SEU	SEUSS transcriptional co-regul...		Potri.007G109400 [exp]	37.41	0.6307
AT3G46980		PHT4;3	phosphate transporter 4;3 (.1....		Potri.001G248200 [exp]	42.04	0.6091
AT4G36630		EMB2754	EMBRYO DEFECTIVE 2754, Vacuola...		Potri.005G123000 [exp]	48.21	0.5812
AT4G34310			alpha/beta-Hydrolases superfam...		Potri.002G128201 [exp]	63.07	0.5779
AT5G22050			Protein kinase superfamily pro...		Potri.009G015600 [exp]	65.29	0.6205

Compare expression of checked genes

Potri.001G198501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.