Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33090 49 / 7e-08 ATAPM1, APM1 aminopeptidase M1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G039200 [exp] 122 / 9e-34 AT4G33090 1102 / 0.0 aminopeptidase M1 (.1) Potri.006G224500 [exp] 49 / 6e-08 AT4G33090 1356 / 0.0 aminopeptidase M1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025002 [exp] 44 / 5e-06 AT4G33090 1196 / 0.0 aminopeptidase M1 (.1) Lus10026448 [exp] 42 / 1e-05 AT4G33090 1389 / 0.0 aminopeptidase M1 (.1) Lus10025001 [exp] 38 / 0.0005 AT4G33090 1385 / 0.0 aminopeptidase M1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0126 [poplar] [flax] Peptidase_MA PF01433 [poplar] [flax] Peptidase_M1 Peptidase family M1 domain
Representative CDS sequence Show only first row Show all	>Potri.001G199000.2 pacid=42791367 polypeptide=Potri.001G199000.2.p locus=Potri.001G199000 ID=Potri.001G199000.2.v4.1 annot-version=v4.1 ATGTGTAGAATCATTAAACCCAATATGTTTATCGTCTTAAATGCTCTTGAATTCAATATCCATGGAGTCTCGTTCATTGCCTCTCAGAACCAACAGCAGT ATCGTCCATGTGATGTTGTTTTGGATGAAGATGATGAGAGATTTGTAGTGGTCTTCGAAGAAACACTTGATGTTGGCGATGGAATGCTAAGGATTGGCTT TTCTGGAATTCTTAATGAGCATTTGAGGGTTCTCTACAGATGTACTTACATGGATGGAGAAGAGAAGAAGAATATGGCGATACTCAGTTGA
AA sequence Show only first row Show all	>Potri.001G199000.2 pacid=42791367 polypeptide=Potri.001G199000.2.p locus=Potri.001G199000 ID=Potri.001G199000.2.v4.1 annot-version=v4.1 MCRIIKPNMFIVLNALEFNIHGVSFIASQNQQQYRPCDVVLDEDDERFVVVFEETLDVGDGMLRIGFSGILNEHLRVLYRCTYMDGEEKKNMAILS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33090		ATAPM1, APM1	aminopeptidase M1 (.1)		Potri.001G199000 [exp]	0	1
AT2G14520			CBS domain-containing protein ...		Potri.001G288000 [exp]	15.29	0.6409
					Potri.001G302801 [exp]	17.20	0.7316
AT2G33710	AP2_ERF		Integrase-type DNA-binding sup...		Potri.005G087200 [exp]	22.00	0.7099
					Potri.014G039466 [exp]	23.23	0.6557
AT5G07900			Mitochondrial transcription te...		Potri.009G021701 [exp]	25.09	0.6808
					Potri.017G080801 [exp]	27.98	0.7258
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Potri.003G108500 [exp]	31.27	0.7005	Pt-TIP5.1
AT3G10040	Trihelix		sequence-specific DNA binding ...		Potri.006G117500 [exp]	32.18	0.6500
AT3G10040	Trihelix		sequence-specific DNA binding ...		Potri.016G096300 [exp]	36.46	0.7044
AT1G32560		AtLEA4-1	Late Embryogenesis Abundant 4-...		Potri.003G090501 [exp]	36.74	0.6262

Compare expression of checked genes

Potri.001G199000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.