Potri.001G200200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G55160 141 / 1e-42 unknown protein
AT2G19530 79 / 2e-18 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G151200 107 / 8e-30 AT1G55160 90 / 7e-24 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019322 110 / 7e-31 AT1G55160 126 / 3e-37 unknown protein
Lus10011503 100 / 1e-26 AT1G55160 130 / 6e-39 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G200200.2 pacid=42791484 polypeptide=Potri.001G200200.2.p locus=Potri.001G200200 ID=Potri.001G200200.2.v4.1 annot-version=v4.1
ATGAAGGCAGAAGAAGAAGGAGGTCTAAAGCTCTTCACCAACAAACCCAAGAAAGCGCAACTAAAAGCAAAGGATTTGTCTTCACCAACAACAGCAACAG
GGACATCATCATCATCATCATCTGCTGCTGCAGCTGCATCATACAAAATGGGGTCTCAGTCTACCGCACCTCCACCCCCCCCTCAGCCTCCAAAGGAGTC
TTTCGCTAGGCGTTACAAGTTCCTTTGGCCCCTTATTTTGACTGTCAATCTCAGTGTTGGAGCTTACTTGTTCATGAGAACGAAGAAAAAGGATACAGTC
CAGGAGGAGGAAGTTTCAAGCAAAATTCCTTCATCCACTCCTAGTACAACCGCTCCAGTTTCTGAGACACCCATACCATCACCTACCATTTCTGAAGTAG
TGAAGCTATGTGAACCTATTCGAGAGGATCAGCAGCGTGAACTATTCAAGTGGATTTTGGAAGAAAAAAGAAAAGTGAAACCAAAAGATTCAGAAGAGAG
AAAGCGCATTGATGATGAGAAAGCTATTCTCAAACAATTCATTCGAGCAAAATCCATCCCAAGCATCTAA
AA sequence
>Potri.001G200200.2 pacid=42791484 polypeptide=Potri.001G200200.2.p locus=Potri.001G200200 ID=Potri.001G200200.2.v4.1 annot-version=v4.1
MKAEEEGGLKLFTNKPKKAQLKAKDLSSPTTATGTSSSSSSAAAAASYKMGSQSTAPPPPPQPPKESFARRYKFLWPLILTVNLSVGAYLFMRTKKKDTV
QEEEVSSKIPSSTPSTTAPVSETPIPSPTISEVVKLCEPIREDQQRELFKWILEEKRKVKPKDSEERKRIDDEKAILKQFIRAKSIPSI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G55160 unknown protein Potri.001G200200 0 1
AT3G63120 CYCP1;1 cyclin p1;1 (.1) Potri.002G052800 3.46 0.9130
AT1G75280 NmrA-like negative transcripti... Potri.002G034400 6.78 0.9132
AT3G54140 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE T... Potri.006G096800 6.92 0.9023
AT3G16920 ATCTL2 chitinase-like protein 2 (.1) Potri.010G141600 7.34 0.9156
AT1G47200 WPP2 WPP domain protein 2 (.1) Potri.002G122000 8.36 0.9048 Pt-MAF1.1
AT4G29850 Eukaryotic protein of unknown ... Potri.018G133500 8.94 0.9086
AT5G23750 Remorin family protein (.1.2) Potri.001G107000 14.83 0.8924
AT5G12250 TUB6 beta-6 tubulin (.1) Potri.001G104600 15.81 0.8938
AT1G36380 unknown protein Potri.005G171000 18.13 0.8584
AT4G37235 Uncharacterised protein family... Potri.007G033600 18.33 0.8840

Potri.001G200200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.