Potri.001G202000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15900 50 / 3e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011486 59 / 1e-11 AT3G15900 64 / 1e-13 unknown protein
Lus10023126 49 / 7e-08 AT3G15900 62 / 1e-12 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G202000.1 pacid=42791835 polypeptide=Potri.001G202000.1.p locus=Potri.001G202000 ID=Potri.001G202000.1.v4.1 annot-version=v4.1
ATGGCAATGATGACAAGTAGAGCAGCAACCAGAGGTCCTCCTAACCTCAGCTCTTGTTCCTCATATAACCCAACAAGAAATAAGCTTACAATAATGGGTT
CCAGCTTCCTCAACAACCCATGTTTTCTGCTCTCATCAAATATTGCCAAGCTACAAAAGTTTGTCCCTGCACAGGCCTCCAATTCTCAAGGAGGAGGAGG
AGGAGGAGGAGGAGGAGGAGGAGAAGGGGAAGAAACCCCCAGTTTAAATGGCACCACCAGTGGTACCTCTCAGGAGGATTGGAACTATTTATTGAAACTA
GGGGCTGGTTCTCTTGCTGGTGCAGCTGTAATAAAGTATGGAAGCATCCTTTTTCCTGAGATAACAAGACCAAACATCTTACAGGCGCTGATTATGATAT
CAACTCCTGTCGTTGTAGCCGTTGTGCTCTTGATCAAGCTAAGTTATCAAGAGTGA
AA sequence
>Potri.001G202000.1 pacid=42791835 polypeptide=Potri.001G202000.1.p locus=Potri.001G202000 ID=Potri.001G202000.1.v4.1 annot-version=v4.1
MAMMTSRAATRGPPNLSSCSSYNPTRNKLTIMGSSFLNNPCFLLSSNIAKLQKFVPAQASNSQGGGGGGGGGGGEGEETPSLNGTTSGTSQEDWNYLLKL
GAGSLAGAAVIKYGSILFPEITRPNILQALIMISTPVVVAVVLLIKLSYQE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15900 unknown protein Potri.001G202000 0 1
AT5G57170 Tautomerase/MIF superfamily pr... Potri.006G075100 3.31 0.9746
AT4G20360 AtRab8D, AtRABE... RAB GTPase homolog E1B (.1) Potri.001G110200 7.61 0.9694
AT5G62140 unknown protein Potri.012G134500 7.93 0.9689
AT3G26070 Plastid-lipid associated prote... Potri.001G209600 11.83 0.9683
AT5G16660 unknown protein Potri.013G078100 12.84 0.9544
AT5G07020 proline-rich family protein (.... Potri.003G192800 14.83 0.9677
AT5G13510 EMB3136 EMBRYO DEFECTIVE 3136, Ribosom... Potri.010G215900 18.97 0.9666
AT1G74880 NdhO, NDH-O NADH dehydrogenase-like comple... Potri.007G106500 21.35 0.9657
AT3G08010 ATAB2 RNA binding (.1) Potri.009G059800 22.13 0.9646
AT1G32060 PRK phosphoribulokinase (.1) Potri.003G099400 22.91 0.9664

Potri.001G202000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.