Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15890 129 / 8e-37 Protein kinase superfamily protein (.1) AT1G52540 126 / 2e-35 Protein kinase superfamily protein (.1) AT3G53380 84 / 3e-19 Concanavalin A-like lectin protein kinase family protein (.1) AT3G24790 82 / 7e-19 Protein kinase superfamily protein (.1) AT3G24540 82 / 1e-18 AtPERK3 proline-rich extensin-like receptor kinase 3, Protein kinase superfamily protein (.1) AT1G54820 82 / 1e-18 Protein kinase superfamily protein (.1) AT5G56460 80 / 5e-18 Protein kinase superfamily protein (.1) AT5G18910 80 / 6e-18 Protein kinase superfamily protein (.1) AT5G02800 79 / 6e-18 CDL1 CDG1-like 1, Protein kinase superfamily protein (.1) AT3G24550 79 / 1e-17 ATPERK1 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G204000 [exp] 285 / 2e-97 AT1G52540 427 / 7e-150 Protein kinase superfamily protein (.1) Potri.003G032100 [exp] 243 / 5e-81 AT1G52540 451 / 3e-159 Protein kinase superfamily protein (.1) Potri.006G173800 [exp] 118 / 3e-32 AT1G52540 344 / 4e-117 Protein kinase superfamily protein (.1) Potri.012G132200 [exp] 107 / 1e-28 AT1G52540 335 / 3e-114 Protein kinase superfamily protein (.1) Potri.015G134500 [exp] 106 / 6e-28 AT1G52540 335 / 2e-113 Protein kinase superfamily protein (.1) Potri.004G018500 [exp] 87 / 2e-20 AT3G20530 473 / 2e-167 Protein kinase superfamily protein (.1) Potri.001G368300 [exp] 86 / 6e-20 AT5G55830 853 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.016G087800 [exp] 85 / 1e-19 AT3G53380 881 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.004G212600 [exp] 82 / 9e-19 AT2G28250 588 / 0.0 Protein kinase superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023130 [exp] 170 / 3e-52 AT1G52540 473 / 3e-168 Protein kinase superfamily protein (.1) Lus10011490 [exp] 169 / 4e-52 AT3G15890 466 / 2e-165 Protein kinase superfamily protein (.1) Lus10019988 [exp] 125 / 1e-34 AT1G52540 348 / 2e-118 Protein kinase superfamily protein (.1) Lus10006985 [exp] 121 / 2e-33 AT1G52540 348 / 8e-119 Protein kinase superfamily protein (.1) Lus10001323 [exp] 121 / 2e-33 AT1G52540 353 / 3e-120 Protein kinase superfamily protein (.1) Lus10031673 [exp] 105 / 2e-27 AT1G52540 338 / 1e-114 Protein kinase superfamily protein (.1) Lus10026493 [exp] 89 / 4e-21 AT3G53380 872 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10019923 [exp] 89 / 5e-21 AT3G53380 927 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10022521 [exp] 84 / 8e-21 AT5G55830 263 / 9e-85 Concanavalin A-like lectin protein kinase family protein (.1) Lus10000968 [exp] 83 / 6e-19 AT1G77280 844 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.001G203601.1 pacid=42787570 polypeptide=Potri.001G203601.1.p locus=Potri.001G203601 ID=Potri.001G203601.1.v4.1 annot-version=v4.1 ATGCTTGGGAAAGCATCAGAGAGCTGTGATGTATACAGCTTTGGCATTCTCTTGCTAGAGCTTGCTACTGGAAAGAGACCACTTGAGAAGATGAGTCCCA CAGTTAAAAGAACAATTACAGATTGGGCTCTGCCATTGGCTTGTGAGAGGAAGTTCAGTGAACTGGCAGATCCCGAGCTGAATGGGAAGTATGACGAGGA AGAGTTGAGAAGGGTTGTCTTTGTCTCTCTTGTTTGTGCTCACACTCAGCCGGAGAGAAGACCCACAATGCTTGATGTGGTAGAGCTGCTGAAGGGAGAG TCCAAGGAGAAATTATCCAAACTAGAAAATGATGAAATGTTCAAGGCCCCTCAGGCCGCTGATTTTGATGATAAAGAAATATCGATTGCCGAAAACAGCT CAGACTTCATCTCGGAGGAGAAGGACATGAACAGGGAAGTGAAAGAGATTGTACAGGAAAATACTCATAATAGCTGA
AA sequence Show only first row Show all	>Potri.001G203601.1 pacid=42787570 polypeptide=Potri.001G203601.1.p locus=Potri.001G203601 ID=Potri.001G203601.1.v4.1 annot-version=v4.1 MLGKASESCDVYSFGILLLELATGKRPLEKMSPTVKRTITDWALPLACERKFSELADPELNGKYDEEELRRVVFVSLVCAHTQPERRPTMLDVVELLKGE SKEKLSKLENDEMFKAPQAADFDDKEISIAENSSDFISEEKDMNREVKEIVQENTHNS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15890			Protein kinase superfamily pro...		Potri.001G203601 [exp]	0	1
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.013G029600 [exp]	3.46	0.9116
AT3G10980		SAG20, WI12, AT...	PLAC8 family protein (.1)		Potri.008G075300 [exp]	7.07	0.8990
AT1G47550		SEC3A	exocyst complex component sec3...		Potri.002G131400 [exp]	18.70	0.8708
AT2G24230			Leucine-rich repeat protein ki...		Potri.018G107400 [exp]	19.77	0.8720
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Potri.017G057500 [exp]	22.49	0.8729
AT4G19350		EMB3006	embryo defective 3006 (.1)		Potri.004G235300 [exp]	23.23	0.8741
AT4G02580			NADH-ubiquinone oxidoreductase...		Potri.005G218000 [exp]	23.81	0.8919
AT1G75280			NmrA-like negative transcripti...		Potri.005G228700 [exp]	28.28	0.8622	PCBER7
AT1G53320	TUB	AtTLP7	tubby like protein 7 (.1)		Potri.011G109300 [exp]	29.24	0.8542
AT5G66060			2-oxoglutarate (2OG) and Fe(II...		Potri.007G060800 [exp]	30.98	0.8720

Compare expression of checked genes

Potri.001G203601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.