Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18840 64 / 1e-13 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT2G35030 64 / 2e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G09410 58 / 2e-11 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G32415 57 / 4e-11 pentatricopeptide (PPR) repeat-containing protein (.1) AT4G37170 57 / 6e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G19020 56 / 2e-10 MEF18 mitochondrial editing factor 18 (.1) AT4G02750 54 / 6e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G24000 54 / 8e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G14470 54 / 9e-10 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G56690 53 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G046200 [exp] 62 / 6e-13 AT2G44880 676 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.004G125500 [exp] 62 / 1e-12 AT3G29230 829 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G006400 [exp] 59 / 2e-11 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G048800 [exp] 58 / 3e-11 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G005400 [exp] 57 / 4e-11 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G091600 [exp] 57 / 6e-11 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G087300 [exp] 56 / 9e-11 AT1G32415 851 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.016G038400 [exp] 56 / 1e-10 AT2G35030 701 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G072500 [exp] 55 / 2e-10 AT3G21470 565 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022655 [exp] 60 / 4e-13 AT2G35030 94 / 9e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013540 [exp] 62 / 9e-13 AT4G02750 1075 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013149 [exp] 59 / 1e-11 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030932 [exp] 59 / 2e-11 AT3G29230 318 / 3e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009487 [exp] 58 / 3e-11 AT1G71490 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003422 [exp] 58 / 3e-11 AT2G44880 679 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10025488 [exp] 56 / 8e-11 AT1G71490 106 / 9e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028907 [exp] 56 / 1e-10 AT4G22760 632 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10007341 [exp] 56 / 2e-10 AT2G42920 610 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10010320 [exp] 55 / 4e-10 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF12854 [poplar] [flax] PPR_1 PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.001G204500.1 pacid=42790999 polypeptide=Potri.001G204500.1.p locus=Potri.001G204500 ID=Potri.001G204500.1.v4.1 annot-version=v4.1 ATGTTAACTGCGTTTCTGCAGACCGGTGCTATAAAGAATGATAGGAAGTTGTTTGATGAAATTCCGGACAGAAATGTTTCATCATGGAATTCGATTATAA CAGGGTATTGTGGAAGTGGGCTGATGAGGGAAGCGAGGTATTTGTTTGATAGGATTGGGGGATTGAAGAATCTTGTTTCTTCGATGGTTGTGATTTCTTG GAATGCCCATCAGGCTTTAGACTACACAAAAGGGGCTTGTTCCCATGTCACCAAGTGA
AA sequence Show only first row Show all	>Potri.001G204500.1 pacid=42790999 polypeptide=Potri.001G204500.1.p locus=Potri.001G204500 ID=Potri.001G204500.1.v4.1 annot-version=v4.1 MLTAFLQTGAIKNDRKLFDEIPDRNVSSWNSIITGYCGSGLMREARYLFDRIGGLKNLVSSMVVISWNAHQALDYTKGACSHVTK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35030			Pentatricopeptide repeat (PPR)...		Potri.001G204500 [exp]	0	1
AT1G17370		UBP1B	oligouridylate binding protein...		Potri.003G069000 [exp]	12.72	0.7812
AT3G12810		CHR13, SRCAP, P...	PHOTOPERIOD-INDEPENDENT EARLY ...		Potri.012G057601 [exp]	13.11	0.8356
					Potri.010G065733 [exp]	17.74	0.8339
AT5G19290			alpha/beta-Hydrolases superfam...		Potri.010G222300 [exp]	20.49	0.8315
AT2G39020			Acyl-CoA N-acyltransferases (N...		Potri.008G037700 [exp]	22.24	0.8170
AT5G09995			unknown protein		Potri.007G081800 [exp]	27.96	0.8023
AT2G28480			RNA-binding CRS1 / YhbY (CRM) ...		Potri.007G129600 [exp]	28.98	0.6591
AT3G11460			Pentatricopeptide repeat (PPR)...		Potri.006G211400 [exp]	32.24	0.7016
					Potri.014G093150 [exp]	37.52	0.8146
AT4G35940			unknown protein		Potri.009G134800 [exp]	39.00	0.6916

Compare expression of checked genes

Potri.001G204500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.