Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64530 222 / 2e-74 NAC ANAC104, XND1 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) AT5G63790 114 / 9e-31 NAC ANAC102 NAC domain containing protein 102 (.1) AT1G61110 111 / 8e-30 NAC ANAC025 NAC domain containing protein 25 (.1) AT1G01720 110 / 1e-29 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G69490 109 / 2e-29 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT4G27410 107 / 2e-28 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT5G08790 107 / 2e-28 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G15510 107 / 4e-28 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT3G04070 105 / 2e-27 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G77450 104 / 2e-27 NAC ANAC032 NAC domain containing protein 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G022800 [exp] 299 / 6e-105 AT5G64530 231 / 5e-78 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.005G064100 [exp] 201 / 3e-66 AT5G64530 199 / 3e-65 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.007G105000 [exp] 200 / 1e-65 AT5G64530 183 / 3e-59 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.011G046700 [exp] 117 / 1e-31 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.004G038000 [exp] 117 / 1e-31 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.002G081000 [exp] 112 / 4e-30 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.003G166500 [exp] 110 / 4e-30 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.001G404400 [exp] 112 / 7e-30 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.019G031400 [exp] 111 / 2e-29 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000206 [exp] 229 / 3e-77 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035648 [exp] 229 / 3e-77 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035647 [exp] 229 / 3e-77 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10010747 [exp] 227 / 2e-76 AT5G64530 259 / 4e-89 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10011215 [exp] 125 / 2e-34 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10018469 [exp] 120 / 6e-33 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10032657 [exp] 118 / 7e-32 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 117 / 1e-31 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10003269 [exp] 115 / 8e-31 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2) Lus10025690 [exp] 111 / 7e-30 AT1G01720 405 / 1e-143 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.001G206900.1 pacid=42789100 polypeptide=Potri.001G206900.1.p locus=Potri.001G206900 ID=Potri.001G206900.1.v4.1 annot-version=v4.1 ATGGGTAGTGTTAATCTTCCACCTGGTTTTCGGTTTTGCCCTAGTGATGAAGAGCTCGTAGTGCATTTTCTTCATCGTAAAGCAGCTCTTTTACCTTGCC ATCCAGATGTGATCCCCGATCTTGGTCTTTATCCTTATGATCCATGGCAACTTGATGGCAAAGCGCTGTCCGAGGGTAAACAACGCTATTTCTATAGCAG AAGGACACAAAACAAGATTACCAGCAATGGATGCTGGAAGCCAATGGCCGGCCGTGGCGAAGAGCTTGTGCTTGCAAGTGATAGCAACAAAACAGTAGGA ACGAAGAAGTACTTTCTGTTTTATACAGCTGATGGTGTAAGAACTAACTGGGTAATGGAAGAGTACAGACTATCAGGATTTGACACTTCTGCCTCTACTA AAACAAGAAACCGGCAAAAACAAGATTATAGTAAATGGGTTATTTGTCGAGTCTACGAGCGAGATCTTGACGAGGACGACAGTGGAACAGATCAGCTCTC ATGTCTAGATGAAGTTTTTCTATCTTTGGACGATCTTGATGAAATAAGTTTGCCAAACTAA
AA sequence Show only first row Show all	>Potri.001G206900.1 pacid=42789100 polypeptide=Potri.001G206900.1.p locus=Potri.001G206900 ID=Potri.001G206900.1.v4.1 annot-version=v4.1 MGSVNLPPGFRFCPSDEELVVHFLHRKAALLPCHPDVIPDLGLYPYDPWQLDGKALSEGKQRYFYSRRTQNKITSNGCWKPMAGRGEELVLASDSNKTVG TKKYFLFYTADGVRTNWVMEEYRLSGFDTSASTKTRNRQKQDYSKWVICRVYERDLDEDDSGTDQLSCLDEVFLSLDDLDEISLPN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Potri.001G206900 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Potri.004G069001 [exp]	7.07	0.7368
AT4G24520		AR1, ATR1	ARABIDOPSIS CYTOCHROME REDUCTA...		Potri.005G153800 [exp]	10.81	0.6894
AT1G05870			Protein of unknown function (D...		Potri.017G032800 [exp]	14.24	0.7032
AT3G57062			unknown protein		Potri.016G038300 [exp]	14.28	0.7043
AT5G14210			Leucine-rich repeat protein ki...		Potri.001G333300 [exp]	14.69	0.6954
AT3G12120		FAD2	fatty acid desaturase 2 (.1.2)		Potri.016G046200 [exp]	17.49	0.7339	FAD2.3
AT5G03860		MLS	malate synthase (.1.2)		Potri.015G092000 [exp]	27.49	0.7181
					Potri.005G167800 [exp]	33.49	0.6548
AT5G24090		ATCHIA	chitinase A (.1)		Potri.014G092800 [exp]	37.14	0.6507	Pt-CHI3.5
AT2G12550		NUB1	homolog of human NUB1, ubiquit...		Potri.018G118143 [exp]	40.98	0.6668

Compare expression of checked genes

Potri.001G206900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.