Potri.001G207600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G207600.1 pacid=42792632 polypeptide=Potri.001G207600.1.p locus=Potri.001G207600 ID=Potri.001G207600.1.v4.1 annot-version=v4.1
ATGGGAGGCTGCGCTAGTGTACCAAAGGACTTGAAGGATGAGGTTGGCTCCGCCCCAGCACCCGAGCCTCCCATGGAGGAAACCGCGGAGAACAATGAAG
CTGTGAAGGTTGAGCTAGAGGCCGTAGAAAAGGTTGAAGAAGAAAATGCTGAGAAGAGTGACGATTATAAGAAGTCCCTTGGATCATTGCTTAATGAGAA
TGAAGTACAGATGGAAACAACAAGCGAAAGCAAGGAAGAGGAAGTTCCATGCAAGCAAAACGAAGAACAAGCAGCAACTGAGGCTCCTGCGGCTGAATCA
GAGAAAGAACAAATCAAGAATGCTGAGGAAAAGGCTACAGGAGAAAAGAAAGAAGACATTTAG
AA sequence
>Potri.001G207600.1 pacid=42792632 polypeptide=Potri.001G207600.1.p locus=Potri.001G207600 ID=Potri.001G207600.1.v4.1 annot-version=v4.1
MGGCASVPKDLKDEVGSAPAPEPPMEETAENNEAVKVELEAVEKVEEENAEKSDDYKKSLGSLLNENEVQMETTSESKEEEVPCKQNEEQAATEAPAAES
EKEQIKNAEEKATGEKKEDI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G207600 0 1
AT4G02630 Protein kinase superfamily pro... Potri.005G139500 9.59 0.8560
AT1G75550 glycine-rich protein (.1) Potri.005G234601 12.12 0.7607
AT2G25600 AKT6, SPIK Shaker pollen inward K+ channe... Potri.006G249900 19.05 0.7788
AT1G66910 Protein kinase superfamily pro... Potri.017G116900 20.12 0.7344
AT3G50120 Plant protein of unknown funct... Potri.016G039733 20.19 0.7856
AT5G02750 SGR9 SHOOT GRAVITROPISM 9, RING/U-b... Potri.016G082500 27.20 0.7613
AT1G78980 SRF5 STRUBBELIG-receptor family 5 (... Potri.007G002600 41.74 0.7862
AT1G20670 DNA-binding bromodomain-contai... Potri.016G141400 47.95 0.7806
Potri.002G247200 50.59 0.7638
AT1G79670 WAKL22, RFO1 RESISTANCE TO FUSARIUM OXYSPOR... Potri.001G040000 61.70 0.7766

Potri.001G207600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.