Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26070 253 / 5e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT3G26080 229 / 1e-75 plastid-lipid associated protein PAP / fibrillin family protein (.1) AT5G19940 55 / 8e-09 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) AT5G09820 54 / 2e-08 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) AT4G22240 44 / 7e-05 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT2G35490 42 / 0.0002 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT4G04020 42 / 0.0003 FIB fibrillin (.1) AT3G23400 41 / 0.0004 FIB4 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G020700 [exp] 268 / 5e-90 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.004G003200 [exp] 54 / 2e-08 AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.008G169100 [exp] 50 / 5e-07 AT3G23400 267 / 2e-89 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.001G137900 [exp] 49 / 1e-06 AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.003G095900 [exp] 47 / 5e-06 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.001G011700 [exp] 43 / 0.0001 AT1G51110 532 / 0.0 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020982 [exp] 293 / 2e-100 AT3G26070 265 / 1e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10001099 [exp] 56 / 6e-09 AT4G22240 362 / 5e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10014790 [exp] 55 / 1e-08 AT4G22240 363 / 2e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10020860 [exp] 54 / 1e-08 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Lus10033514 [exp] 54 / 2e-08 AT5G09820 270 / 3e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Lus10026221 [exp] 50 / 4e-07 AT5G19940 276 / 4e-94 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Lus10030987 [exp] 48 / 3e-06 AT2G35490 354 / 5e-121 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10010444 [exp] 47 / 9e-06 AT1G51110 490 / 2e-173 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10035384 [exp] 45 / 3e-05 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10042448 [exp] 44 / 6e-05 AT5G19940 250 / 9e-84 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04755 [poplar] [flax] PAP_fibrillin PAP_fibrillin
Representative CDS sequence Show only first row Show all	>Potri.001G209600.4 pacid=42793482 polypeptide=Potri.001G209600.4.p locus=Potri.001G209600 ID=Potri.001G209600.4.v4.1 annot-version=v4.1 ATGACAATGGCCTTATCTTCATCTCCACACTCTCCAGCAGTCCTCACAGCCTCTCAATTCTCAACTCACTCACCATTTCCAAAACTCACCACCTCTCACT TCTTCTTCTCTACTGGTAAACCCTCCAACCAAACCAGCTACTTTAACCTTTCTTCAAGCTACTCCACCATTGATAGATCATGGAGCGCTAAGGTTTCTTT CTTTCCTGCTTTCTTGAAAAAGGGCAAGAGTGCTAAGGTCCTCAAGGAGGAACTTCTTGAGGCCATTGATTCCCTTGATCGTGGAGCAGACGCCATTCCT GAAGACCAACAAAGAGTTGATGAGATTGCTCGGAAGCTTGAAGCAGTGAATCCGACAAAGGAGCCATTGAAATCTGGTTTACTAAACGGGAAATGGGAGC TTCTATACACCACTTCACAATCTATTTTGCAAACACAAAGGCCAAAGCTCTTAAGATCCAGGACAAACTACCAAGCAATCAATGCTGATATACTTAGGGC CCAGAACATGGAATCTTGGCCATTCTTCAACCAGGTAACTGCAGATTTAACACCATTGAGTGCAAAAAAAGTTGCTGTAAAGTTCGATGTCTTCAAGATT CTTGGTCTGATACCAGTTAAGGCACCAGGAAGAGCTCGTGGTGAGCTGGAAATCACTTATTTGGATGAAGAATTACGAGTATCCAGGGGTGACAAAGGAA ACCTGTTTGTCTTGAAAATGGTTGATCCATCCTACCGTGTTCCTGTCTGA
AA sequence Show only first row Show all	>Potri.001G209600.4 pacid=42793482 polypeptide=Potri.001G209600.4.p locus=Potri.001G209600 ID=Potri.001G209600.4.v4.1 annot-version=v4.1 MTMALSSSPHSPAVLTASQFSTHSPFPKLTTSHFFFSTGKPSNQTSYFNLSSSYSTIDRSWSAKVSFFPAFLKKGKSAKVLKEELLEAIDSLDRGADAIP EDQQRVDEIARKLEAVNPTKEPLKSGLLNGKWELLYTTSQSILQTQRPKLLRSRTNYQAINADILRAQNMESWPFFNQVTADLTPLSAKKVAVKFDVFKI LGLIPVKAPGRARGELEITYLDEELRVSRGDKGNLFVLKMVDPSYRVPV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G26070			Plastid-lipid associated prote...		Potri.001G209600 [exp]	0	1
AT2G33450			Ribosomal L28 family (.1)		Potri.010G068500 [exp]	1.00	0.9899
AT1G32060		PRK	phosphoribulokinase (.1)		Potri.003G099400 [exp]	2.44	0.9880
AT5G07020			proline-rich family protein (....		Potri.003G192800 [exp]	3.46	0.9869
AT5G43750		PnsB5, NDH18	Photosynthetic NDH subcomplex...		Potri.010G078800 [exp]	4.00	0.9859
AT1G18730		PnsB4, NDF6	Photosynthetic NDH subcomplex...		Potri.012G068500 [exp]	4.58	0.9798
AT3G08010		ATAB2	RNA binding (.1)		Potri.009G059800 [exp]	4.89	0.9814
AT5G03940		SRP54CP, CPSRP5...	SIGNAL RECOGNITION PARTICLE 54...		Potri.006G211500 [exp]	5.65	0.9795	Pt-FFC.2
AT5G06690		WCRKC1	WCRKC thioredoxin 1 (.1.2)		Potri.016G059500 [exp]	7.34	0.9638
AT5G07900			Mitochondrial transcription te...		Potri.001G035200 [exp]	8.36	0.9780
AT1G51080			unknown protein		Potri.008G004800 [exp]	8.48	0.9780

Compare expression of checked genes

Potri.001G209600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.