Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05160 123 / 6e-33 REDUCED IN LATERAL GROWTH1 (RUL1) REDUCED IN LATERAL GROWTH1, Leucine-rich repeat protein kinase family protein (.1) AT2G26730 121 / 2e-32 Leucine-rich repeat protein kinase family protein (.1) AT2G36570 117 / 4e-31 Leucine-rich repeat protein kinase family protein (.1) AT1G64210 112 / 2e-29 Leucine-rich repeat protein kinase family protein (.1) AT1G68400 110 / 1e-28 leucine-rich repeat transmembrane protein kinase family protein (.1) AT5G58300 110 / 2e-28 Leucine-rich repeat protein kinase family protein (.1.2) AT4G23740 109 / 4e-28 Leucine-rich repeat protein kinase family protein (.1) AT1G48480 107 / 2e-27 RKL1 receptor-like kinase 1 (.1) AT4G31250 106 / 4e-27 Leucine-rich repeat protein kinase family protein (.1) AT3G17840 106 / 5e-27 RLK902 receptor-like kinase 902 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G020600 [exp] 236 / 1e-74 AT2G36570 293 / 6e-90 Leucine-rich repeat protein kinase family protein (.1) Potri.006G117200 [exp] 123 / 6e-33 AT2G36570 806 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.018G074300 [exp] 115 / 4e-30 AT2G26730 550 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.019G131500 [exp] 114 / 6e-30 AT5G58300 860 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Potri.019G062100 [exp] 114 / 8e-30 AT5G58300 750 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Potri.013G158800 [exp] 113 / 2e-29 AT5G58300 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Potri.012G044600 [exp] 110 / 2e-28 AT1G48480 719 / 0.0 receptor-like kinase 1 (.1) Potri.004G066300 [exp] 110 / 2e-28 AT3G02880 301 / 4e-94 Leucine-rich repeat protein kinase family protein (.1) Potri.016G139200 [exp] 109 / 4e-28 AT5G58300 691 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019113 [exp] 118 / 3e-31 AT5G58300 848 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Lus10034446 [exp] 117 / 9e-31 AT5G58300 847 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Lus10021673 [exp] 117 / 1e-30 AT5G58300 862 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Lus10035012 [exp] 117 / 1e-30 AT5G58300 867 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Lus10017756 [exp] 116 / 1e-30 AT2G26730 877 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10027568 [exp] 114 / 1e-29 AT4G23740 652 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10017178 [exp] 114 / 1e-29 AT2G36570 872 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10018255 [exp] 110 / 2e-29 AT2G36570 271 / 4e-85 Leucine-rich repeat protein kinase family protein (.1) Lus10039321 [exp] 109 / 4e-28 AT4G23740 649 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10040653 [exp] 108 / 1e-27 AT1G68400 331 / 5e-105 leucine-rich repeat transmembrane protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.001G209700.1 pacid=42792658 polypeptide=Potri.001G209700.1.p locus=Potri.001G209700 ID=Potri.001G209700.1.v4.1 annot-version=v4.1 ATGATCAAGAAAGAGGATGAAAGAAAAGGAGGAGGAGATACTACTATTGTTGATGATGGTTTGAGGGATGAGATAGAGGAAAAGGGAAAGGATGTCGATA TCAGAGAAGAAAAAGGGAAGCTTATTTTCATAGAGGAAGAAGCAAAAAGTTTCCAACTGAATGATCTTCTAAAAGTTTCTGCTGAGGGTTTAGGCAAGGG GAACCTGGGAAATTGGTATAAAGCTATGGTGGAAGGCAGGGCCGCTGTTGTTGTAAAGCAAATAAGGGATTTGAAGCCATTAAGTAGTGAGGAATTCACA AGGCAAATGCATATAATTGCTCATCAGAAGCACCCCAATTTGCCACCACTTCTAGCTTACTCCTACTCCAAGGATGAGCAGTTTCTGGTACACAAATATC CACAAAAAGGAAACCTCTTTACTCGCATTCATGGTAGCAGAGGAAGGGACAGGATTCCATGTAGGTGGAGCGCAAGACTATCCATAGCTCGAGGCATTTC ACGAGCCCTGTAG
AA sequence Show only first row Show all	>Potri.001G209700.1 pacid=42792658 polypeptide=Potri.001G209700.1.p locus=Potri.001G209700 ID=Potri.001G209700.1.v4.1 annot-version=v4.1 MIKKEDERKGGGDTTIVDDGLRDEIEEKGKDVDIREEKGKLIFIEEEAKSFQLNDLLKVSAEGLGKGNLGNWYKAMVEGRAAVVVKQIRDLKPLSSEEFT RQMHIIAHQKHPNLPPLLAYSYSKDEQFLVHKYPQKGNLFTRIHGSRGRDRIPCRWSARLSIARGISRAL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05160		REDUCED IN LATE...	REDUCED IN LATERAL GROWTH1, Le...		Potri.001G209700 [exp]	0	1
AT3G54350	FHA	EMB1967	embryo defective 1967, Forkhea...		Potri.005G234300 [exp]	1.41	0.8937
AT1G21730			P-loop containing nucleoside t...		Potri.002G081300 [exp]	1.41	0.8815
AT5G01260			Carbohydrate-binding-like fold...		Potri.009G044800 [exp]	7.14	0.8447
AT2G37320			Tetratricopeptide repeat (TPR)...		Potri.006G215866 [exp]	10.95	0.8303
AT1G12430		AtKINUa, ARK3, ...	phosphatidic acid kinase, Arab...		Potri.001G115100 [exp]	12.48	0.7858	Pt-PAK.2
AT2G26790			Pentatricopeptide repeat (PPR)...		Potri.010G243002 [exp]	13.41	0.8214
AT3G54350	FHA	EMB1967	embryo defective 1967, Forkhea...		Potri.002G028300 [exp]	16.52	0.8237
AT4G23000			Calcineurin-like metallo-phosp...		Potri.014G034400 [exp]	16.91	0.7945
AT4G20060		EMB1895	EMBRYO DEFECTIVE 1895, ARM rep...		Potri.018G118800 [exp]	17.14	0.8246
AT2G15790		CYP40, SQN	SQUINT, CYCLOPHILIN 40, peptid...		Potri.009G106200 [exp]	18.00	0.7865	SQN.1

Compare expression of checked genes

Potri.001G209700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.