Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02420 43 / 8e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G003400 [exp] 149 / 2e-47 AT5G02420 45 / 7e-07 unknown protein Potri.010G231600 [exp] 75 / 5e-18 AT5G02420 44 / 1e-06 unknown protein Potri.008G029600 [exp] 74 / 1e-17 AT5G02420 48 / 5e-08 unknown protein Potri.010G231700 [exp] 53 / 7e-10 AT5G04470 / SIAMESE, cyclin-dependent protein kinase inhibitors (.1) Potri.001G239000 [exp] 42 / 2e-05 AT5G02420 59 / 1e-11 unknown protein Potri.009G030200 [exp] 42 / 3e-05 AT5G02420 49 / 5e-08 unknown protein Potri.016G100000 [exp] 39 / 0.0001 AT5G02220 39 / 1e-05 unknown protein Potri.006G084700 [exp] 39 / 0.0006 AT5G02420 57 / 1e-10 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037925 [exp] 58 / 3e-11 AT5G02420 47 / 2e-07 unknown protein Lus10038653 [exp] 56 / 1e-10 AT5G02420 47 / 2e-07 unknown protein Lus10040827 [exp] 43 / 3e-05 AT3G20898 44 / 8e-06 unknown protein Lus10017454 [exp] 42 / 3e-05 ND 38 / 3e-04 Lus10016559 [exp] 42 / 6e-05 AT2G37610 39 / 2e-04 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G212300.2 pacid=42787613 polypeptide=Potri.001G212300.2.p locus=Potri.001G212300 ID=Potri.001G212300.2.v4.1 annot-version=v4.1 ATGTCAGAAGATCACATAAACCAGAGAGATCTACCAAAGCTTCTACAATCTGCACCACAAGGTCATGAACAAGGAGAGGGGGAGCTCGGGCTTCAGGCTG TTGATGATCAAGAAGAGTGCCGAACAGTGCCAGCCTCTAGTGACCACAAGATACCAACCATTCAAAGCTGCCCGCCAACACCACCCTCTATTGACCAGGC TGTTGATGATCAAGAAGAGTGCAGAACACCAACCTCTAGTGACCACAAGATACCGACCATTCGAAGTTGCCCACCAACACCAAGAAAGAAGGTGCAAGTT TTTGCGCATAAGAGAAAAATTCCAGAGTTTTTCGATACTACAAACAAAGATGAGGTAGAATCGTTTTTTCGATCAAGCTTTGAGGTACCTAGTCGTGTCA ATCAATCTCGTCCCATGAAAAGAAGATGCAGAAGTTATTAA
AA sequence Show only first row Show all	>Potri.001G212300.2 pacid=42787613 polypeptide=Potri.001G212300.2.p locus=Potri.001G212300 ID=Potri.001G212300.2.v4.1 annot-version=v4.1 MSEDHINQRDLPKLLQSAPQGHEQGEGELGLQAVDDQEECRTVPASSDHKIPTIQSCPPTPPSIDQAVDDQEECRTPTSSDHKIPTIRSCPPTPRKKVQV FAHKRKIPEFFDTTNKDEVESFFRSSFEVPSRVNQSRPMKRRCRSY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02420			unknown protein		Potri.001G212300 [exp]	0	1
AT4G08850			Leucine-rich repeat receptor-l...		Potri.019G127200 [exp]	3.87	0.7791
AT1G19220	ARF	IAA22, ARF11, A...	indole-3-acetic acid inducible...		Potri.006G138500 [exp]	8.12	0.7715	Pt-NPH4.2
AT2G29970			Double Clp-N motif-containing ...		Potri.009G046700 [exp]	10.00	0.7597
AT1G35710			Protein kinase family protein ...		Potri.019G122500 [exp]	10.09	0.7489
AT5G54310		NEV, AGD5	NEVERSHED, ARF-GAP domain 5 (....		Potri.011G044100 [exp]	22.44	0.7369
AT3G15355		UBC25 ,PFU1	PHO2 FAMILY UBIQUITIN CONJUGAT...		Potri.001G400300 [exp]	23.23	0.7559
AT5G65550			UDP-Glycosyltransferase superf...		Potri.008G024900 [exp]	23.66	0.7255
AT4G04970		ATGSL01, ATGSL1	GLUCAN SYNTHASE LIKE-1, GLUCAN...		Potri.011G052400 [exp]	23.66	0.7403
AT2G18790		OOP1, HY3, PHYB	OUT OF PHASE 1, phytochrome B ...		Potri.010G145900 [exp]	24.55	0.7359
AT3G23780		NRPE2, DMS2, DR...	DEFECTIVE IN MERISTEM SILENCIN...		Potri.018G019100 [exp]	28.86	0.7144

Compare expression of checked genes

Potri.001G212300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.