Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1) AT1G76590 194 / 2e-62 PLATZ transcription factor family protein (.1) AT1G21000 192 / 1e-61 PLATZ transcription factor family protein (.1.2) AT1G32700 189 / 5e-61 PLATZ transcription factor family protein (.1.2) AT4G17900 181 / 2e-57 PLATZ transcription factor family protein (.1.2) AT1G43000 171 / 1e-53 PLATZ transcription factor family protein (.1) AT5G46710 152 / 2e-46 PLATZ transcription factor family protein (.1) AT1G31040 121 / 5e-34 PLATZ transcription factor family protein (.1) AT2G12646 120 / 2e-33 PLATZ transcription factor family protein (.1) AT3G60670 110 / 7e-30 PLATZ transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G003200 [exp] 357 / 4e-127 AT2G27930 227 / 3e-76 PLATZ transcription factor family protein (.1) Potri.006G119400 [exp] 306 / 2e-107 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1) Potri.016G097100 [exp] 292 / 1e-101 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2) Potri.003G092800 [exp] 200 / 6e-65 AT4G17900 290 / 5e-100 PLATZ transcription factor family protein (.1.2) Potri.005G259000 [exp] 198 / 3e-64 AT1G21000 366 / 1e-129 PLATZ transcription factor family protein (.1.2) Potri.002G002200 [exp] 195 / 5e-63 AT1G21000 365 / 2e-129 PLATZ transcription factor family protein (.1.2) Potri.019G051200 [exp] 194 / 3e-62 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2) Potri.001G141500 [exp] 191 / 2e-61 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2) Potri.013G078500 [exp] 190 / 8e-61 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027735 [exp] 284 / 3e-98 AT1G21000 218 / 9e-72 PLATZ transcription factor family protein (.1.2) Lus10035554 [exp] 273 / 8e-94 AT1G21000 221 / 4e-73 PLATZ transcription factor family protein (.1.2) Lus10014396 [exp] 232 / 1e-77 AT1G76590 202 / 7e-66 PLATZ transcription factor family protein (.1) Lus10000952 [exp] 202 / 2e-65 AT1G21000 347 / 5e-122 PLATZ transcription factor family protein (.1.2) Lus10002700 [exp] 202 / 5e-65 AT1G21000 345 / 1e-120 PLATZ transcription factor family protein (.1.2) Lus10023411 [exp] 189 / 7e-59 AT1G21000 313 / 7e-107 PLATZ transcription factor family protein (.1.2) Lus10030968 [exp] 185 / 1e-58 AT4G17900 299 / 1e-103 PLATZ transcription factor family protein (.1.2) Lus10040292 [exp] 184 / 1e-58 AT1G21000 317 / 3e-110 PLATZ transcription factor family protein (.1.2) Lus10020337 [exp] 185 / 2e-58 AT4G17900 282 / 3e-96 PLATZ transcription factor family protein (.1.2) Lus10040082 [exp] 184 / 3e-58 AT4G17900 306 / 2e-106 PLATZ transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04640 [poplar] [flax] PLATZ PLATZ transcription factor
Representative CDS sequence Show only first row Show all	>Potri.001G212400.1 pacid=42789260 polypeptide=Potri.001G212400.1.p locus=Potri.001G212400 ID=Potri.001G212400.1.v4.1 annot-version=v4.1 ATGGAAATGCTGGTACCACCGTGGCTTGAATCACTATTATCGACTGCATTCTTCACCGTTTGCCCCAGGCATAGAGATGCCCCACGTAGCGAATGCAACA TGTTCTGCCTTGATTGCAATACCGAAGCCTTTTGCTTCTATTGCCGATCAACTCGACACAAAGATCATTCTGTTATTCAAATCAGAAGGTCATCGTATCA TGATGTTGTTAGGGTTGCTGAGATTCAAAAGGTTTTGGACATTACTGGAGTTCAAACTTACGTTATAAACAGTGCTAGAGTTCTTTTCCTTAATGAGAGA CCACAGCCCAAGAGTAGCACAAGTAAAGGAGTCCCTCATTTATGCGAAATTTGTGGGAGAAGTCTTTTGGATCCCTTTCGTTTCTGTTCTCTAGGATGTA AGCTTGTAAGAATAAAGAACAATGGAGATGCCACCTTTAACTTAAGCACCAAGGACGAGGAAGTAGGGGAAATGAGAGAAGGAATGGGAAGAAGATTGCC ATCAAAGGAAGAAGAAGAATTGCGTGAAGGAAGCCAACAAGATATGTACACAAGCACGCTAACTCCTCCACATTCCAATTCAAGGAGGAGAAAAGGCATC CCCCATAGGGCACCTTTTGGGTCCTAA
AA sequence Show only first row Show all	>Potri.001G212400.1 pacid=42789260 polypeptide=Potri.001G212400.1.p locus=Potri.001G212400 ID=Potri.001G212400.1.v4.1 annot-version=v4.1 MEMLVPPWLESLLSTAFFTVCPRHRDAPRSECNMFCLDCNTEAFCFYCRSTRHKDHSVIQIRRSSYHDVVRVAEIQKVLDITGVQTYVINSARVLFLNER PQPKSSTSKGVPHLCEICGRSLLDPFRFCSLGCKLVRIKNNGDATFNLSTKDEEVGEMREGMGRRLPSKEEEELREGSQQDMYTSTLTPPHSNSRRRKGI PHRAPFGS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27930			PLATZ transcription factor fam...		Potri.001G212400 [exp]	0	1
AT1G67590			Remorin family protein (.1.2)		Potri.008G178300 [exp]	12.72	0.6979
AT3G47400			Plant invertase/pectin methyle...		Potri.015G127800 [exp]	14.14	0.6814	PME.7
AT2G44260			Plant protein of unknown funct...		Potri.009G025102 [exp]	15.74	0.7140
AT2G44260			Plant protein of unknown funct...		Potri.001G232500 [exp]	17.57	0.7052
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Potri.010G080400 [exp]	17.60	0.7011
AT5G18980			ARM repeat superfamily protein...		Potri.008G200500 [exp]	19.62	0.6792
AT2G04235			unknown protein		Potri.001G315950 [exp]	22.20	0.6645
AT4G02110			transcription coactivators (.1...		Potri.014G122400 [exp]	25.69	0.6342
AT4G22670		ATHIP1, TPR11	tetratricopeptide repeat 11, H...		Potri.001G118900 [exp]	26.53	0.6012
AT1G59940		ARR3	response regulator 3 (.1)		Potri.010G037800 [exp]	31.74	0.5751

Compare expression of checked genes

Potri.001G212400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.