Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65430 66 / 1e-13 ATARI8, ARI8 ARABIDOPSIS ARIADNE 8, ARIADNE 8, IBR domain-containing protein (.1) AT1G05890 62 / 3e-12 ATARI5, ARI5 ARABIDOPSIS ARIADNE 5, ARIADNE 5, RING/U-box superfamily protein (.1.2) AT2G31510 57 / 2e-10 ATARI7, ARI7 ARABIDOPSIS ARIADNE 7, ARIADNE 7, IBR domain-containing protein (.1) AT2G31760 51 / 2e-08 ATARI10, ARI10 ARABIDOPSIS ARIADNE 10, ARIADNE 10, RING/U-box superfamily protein (.1) AT2G31770 51 / 2e-08 ATARI9, ARI9 ARABIDOPSIS ARIADNE 9, ARIADNE 9, RING/U-box superfamily protein (.1) AT2G31780 50 / 3e-08 ATARI11 ARABIDOPSIS ARIADNE 11, ARIADNE 11, RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G032000 [exp] 71 / 2e-15 AT2G31510 834 / 0.0 ARABIDOPSIS ARIADNE 7, ARIADNE 7, IBR domain-containing protein (.1) Potri.010G180600 [exp] 71 / 3e-15 AT1G65430 860 / 0.0 ARABIDOPSIS ARIADNE 8, ARIADNE 8, IBR domain-containing protein (.1) Potri.008G077100 [exp] 69 / 1e-14 AT1G65430 836 / 0.0 ARABIDOPSIS ARIADNE 8, ARIADNE 8, IBR domain-containing protein (.1) Potri.007G126900 [exp] 66 / 2e-13 AT2G31510 836 / 0.0 ARABIDOPSIS ARIADNE 7, ARIADNE 7, IBR domain-containing protein (.1) Potri.002G131200 [exp] 62 / 2e-12 AT1G65430 571 / 0.0 ARABIDOPSIS ARIADNE 8, ARIADNE 8, IBR domain-containing protein (.1) Potri.002G131300 [exp] 56 / 5e-10 AT1G65430 536 / 0.0 ARABIDOPSIS ARIADNE 8, ARIADNE 8, IBR domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025566 [exp] 69 / 9e-15 AT2G31510 826 / 0.0 ARABIDOPSIS ARIADNE 7, ARIADNE 7, IBR domain-containing protein (.1) Lus10026856 [exp] 67 / 8e-14 AT1G65430 887 / 0.0 ARABIDOPSIS ARIADNE 8, ARIADNE 8, IBR domain-containing protein (.1) Lus10027027 [exp] 66 / 2e-13 AT2G31510 807 / 0.0 ARABIDOPSIS ARIADNE 7, ARIADNE 7, IBR domain-containing protein (.1) Lus10020229 [exp] 64 / 7e-13 AT1G65430 833 / 0.0 ARABIDOPSIS ARIADNE 8, ARIADNE 8, IBR domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G214201.1 pacid=42789745 polypeptide=Potri.001G214201.1.p locus=Potri.001G214201 ID=Potri.001G214201.1.v4.1 annot-version=v4.1 ATGATACATCATATAATGGCTACGAGGAGGATGGATACTACGATGATGATGGTGATGGTGATTACGATGACTACAACAACTATATATGATGACAACAACA ATGGTGATATGGATACTGGCTACGATGATGGTGGTGGTGAGGATTTCTTGGCATGTCGGAGCCAGCAAAGATGCAAGGAACCAGAGATCATTAGGCAACG TCAGGAGGCTGATATCACAAGAATCTCAACTGTGCTCTCTATATCGAGAAACGAAGCAAGCCTCCTACTTCGTCTCTATGGTTGGAATGTTATCAAAGTA GAGGATGAATGGTTTGGTAATGAAGAAGAGGTGCGTAACATTTCATATTAG
AA sequence Show only first row Show all	>Potri.001G214201.1 pacid=42789745 polypeptide=Potri.001G214201.1.p locus=Potri.001G214201 ID=Potri.001G214201.1.v4.1 annot-version=v4.1 MIHHIMATRRMDTTMMMVMVITMTTTTIYDDNNNGDMDTGYDDGGGEDFLACRSQQRCKEPEIIRQRQEADITRISTVLSISRNEASLLLRLYGWNVIKV EDEWFGNEEEVRNISY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G65430		ATARI8, ARI8	ARABIDOPSIS ARIADNE 8, ARIADNE...		Potri.001G214201 [exp]	0	1
AT5G60580			RING/U-box superfamily protein...		Potri.006G024000 [exp]	2.82	0.9153
					Potri.015G091750 [exp]	6.92	0.8964
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Potri.012G075600 [exp]	10.00	0.9020	Pt-ALDH10.1
AT4G26965			NADH:ubiquinone oxidoreductase...		Potri.003G122100 [exp]	11.22	0.8952
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.004G157800 [exp]	12.00	0.8986
AT4G30960		CIPK6, SIP3, Sn...	SNF1-RELATED PROTEIN KINASE 3....		Potri.006G186200 [exp]	13.63	0.8530	CIPK6.2
					Potri.011G070800 [exp]	17.29	0.8886
AT3G54120			Reticulon family protein (.1)		Potri.016G110200 [exp]	17.32	0.9078
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.011G005200 [exp]	17.74	0.8787
AT1G17280		UBC34	ubiquitin-conjugating enzyme 3...		Potri.003G073100 [exp]	19.44	0.8967

Compare expression of checked genes

Potri.001G214201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.