Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22050 354 / 5e-123 Protein kinase superfamily protein (.1.2) AT1G49730 156 / 5e-43 Protein kinase superfamily protein (.1.2.3.4) AT3G19300 155 / 8e-43 Protein kinase superfamily protein (.1) AT2G23950 128 / 5e-33 Leucine-rich repeat protein kinase family protein (.1) AT1G71830 126 / 2e-32 ATSERK1, SERK1 somatic embryogenesis receptor-like kinase 1 (.1) AT1G20650 121 / 9e-32 ASG5 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1) AT1G34210 122 / 4e-31 ATSERK2, SERK2 somatic embryogenesis receptor-like kinase 2 (.1) AT4G34500 120 / 6e-31 Protein kinase superfamily protein (.1) AT4G30520 121 / 9e-31 SARK SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE, Leucine-rich repeat protein kinase family protein (.1) AT5G18610 120 / 1e-30 Protein kinase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G015600 [exp] 519 / 0 AT5G22050 319 / 4e-109 Protein kinase superfamily protein (.1.2) Potri.004G140301 [exp] 169 / 1e-47 AT1G49730 744 / 0.0 Protein kinase superfamily protein (.1.2.3.4) Potri.009G100400 [exp] 167 / 6e-47 AT3G19300 773 / 0.0 Protein kinase superfamily protein (.1) Potri.010G021500 [exp] 125 / 3e-32 AT5G18610 779 / 0.0 Protein kinase superfamily protein (.1.2) Potri.005G083300 [exp] 124 / 9e-32 AT1G71830 981 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Potri.002G009300 [exp] 121 / 1e-31 AT1G20650 548 / 0.0 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1) Potri.002G254600 [exp] 122 / 5e-31 AT2G20300 947 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Potri.005G252000 [exp] 119 / 6e-31 AT1G20650 531 / 0.0 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1) Potri.013G025700 [exp] 120 / 8e-31 AT1G54820 438 / 7e-152 Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013365 [exp] 333 / 8e-115 AT5G22050 301 / 8e-102 Protein kinase superfamily protein (.1.2) Lus10004110 [exp] 275 / 5e-91 AT5G22050 274 / 1e-90 Protein kinase superfamily protein (.1.2) Lus10014071 [exp] 175 / 9e-50 AT3G19300 777 / 0.0 Protein kinase superfamily protein (.1) Lus10019844 [exp] 173 / 3e-49 AT3G19300 771 / 0.0 Protein kinase superfamily protein (.1) Lus10030741 [exp] 122 / 7e-32 AT1G20650 523 / 0.0 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1) Lus10022129 [exp] 120 / 2e-30 AT3G24550 474 / 3e-159 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1) Lus10016021 [exp] 119 / 2e-30 AT1G20650 516 / 0.0 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1) Lus10006057 [exp] 120 / 3e-30 AT1G71830 954 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Lus10028716 [exp] 119 / 5e-30 AT1G71830 1000 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Lus10012814 [exp] 119 / 5e-30 AT5G18610 807 / 0.0 Protein kinase superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.001G215000.2 pacid=42792207 polypeptide=Potri.001G215000.2.p locus=Potri.001G215000 ID=Potri.001G215000.2.v4.1 annot-version=v4.1 ATGCATCGCTTGATCCAGAAGATGAGGCCTTACCTTCTTGCTTGGCTTCGCCGATCTCGATCTGGTCCAGCATCGTTAGTGAGGCGCTTGTCGTACAAAG ACATGAAGAGGGCAACGGATGGTTTTCGCCGGATAATATATAGCAATACTCATGGGGCAGCCTACAGGGCTAGATTTCAAGATGGCGAGGTTGCGTTGGT GAAGGAAGTAAAAGACTTGAATCAAGGAAAGGACAAGTTTTTCAAGGAAGTTCAACTTTTGGGGCAGTTGCATCATCGCCACCTTCTTGCACTTAAAGGC TTTTCCATAGGATGTAAAAGGTTGCTAGTGTTTGACAATATAGAAAATGGAAGCTTGAAGGAACATCTCAATGATCCTCTTAAAACTCCCTTAAATTGGA ATACAAGGTTACAAATAGCCATTGGTGTAGCAGCTGCATTGGAATATTTGCTTCTCTTCAGCAACCCACCAATATATCATGTTTCCATCAGCGCAAGTAA TGTAATGCTAGATGAAAACTACACTGCAAAGATCTCTGATGTCGGCCTTCTTAATTCCGTTGGAGATTATGTAACAATGCCTCATTCCTCGAATTCAGAA GATTGTATGGACCATGCATGTGGAAACTTAACTTTTCAGCTTGGTGTGCTAATCCTGGAGCTGATAACTGGTCAATCATCAGAAAAAGGAAGCACAGATT TAATCCAGTGGATCCAAGAGTCCCGTTTCCGCAGTTCGATTCAAAAGATGATTGATCCTGATCTAGGAAACAATTACGACTCCAGAGAGCTTAAAAATCT TCTAGCTGTAGCAAGATTGTGTATTAAATCTGGGGATAAGCCAAAATTCTCTATTCCCCAGATATTTAGGTATCTCCAGAAGGTAGAAAATACATGCGAG TAA
AA sequence Show only first row Show all	>Potri.001G215000.2 pacid=42792207 polypeptide=Potri.001G215000.2.p locus=Potri.001G215000 ID=Potri.001G215000.2.v4.1 annot-version=v4.1 MHRLIQKMRPYLLAWLRRSRSGPASLVRRLSYKDMKRATDGFRRIIYSNTHGAAYRARFQDGEVALVKEVKDLNQGKDKFFKEVQLLGQLHHRHLLALKG FSIGCKRLLVFDNIENGSLKEHLNDPLKTPLNWNTRLQIAIGVAAALEYLLLFSNPPIYHVSISASNVMLDENYTAKISDVGLLNSVGDYVTMPHSSNSE DCMDHACGNLTFQLGVLILELITGQSSEKGSTDLIQWIQESRFRSSIQKMIDPDLGNNYDSRELKNLLAVARLCIKSGDKPKFSIPQIFRYLQKVENTCE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G22050			Protein kinase superfamily pro...		Potri.001G215000 [exp]	0	1
AT5G64180			unknown protein		Potri.015G005600 [exp]	5.56	0.9202
AT5G51540			Zincin-like metalloproteases f...		Potri.015G129300 [exp]	8.94	0.9097
AT1G79640			Protein kinase superfamily pro...		Potri.001G037900 [exp]	10.00	0.8970
AT5G04420			Galactose oxidase/kelch repeat...		Potri.010G230300 [exp]	11.74	0.9065
AT2G16400	HD	BLH7	BEL1-like homeodomain 7 (.1)		Potri.002G031000 [exp]	16.70	0.8984
AT1G16860			Ubiquitin-specific protease fa...		Potri.008G006000 [exp]	17.32	0.9067
AT5G01460			LMBR1-like membrane protein (....		Potri.016G116200 [exp]	17.54	0.8893
AT4G35880			Eukaryotic aspartyl protease f...		Potri.007G063800 [exp]	18.24	0.9075
AT5G11730			Core-2/I-branching beta-1,6-N-...		Potri.010G121900 [exp]	18.97	0.8610
AT5G62050		ATOXA1, OXA1AT,...	HOMOLOG OF YEAST OXIDASE ASSEM...		Potri.006G073000 [exp]	20.34	0.8712

Compare expression of checked genes

Potri.001G215000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.