Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22380 272 / 2e-92 NAC ANAC090 NAC domain containing protein 90 (.1) AT3G44350 271 / 6e-92 NAC ANAC061 NAC domain containing protein 61 (.1.2) AT4G27410 142 / 1e-40 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT2G17040 139 / 1e-39 NAC ANAC036 NAC domain containing protein 36 (.1) AT2G02450 139 / 7e-39 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT4G17980 132 / 2e-37 NAC ANAC071 NAC domain containing protein 71 (.1) AT1G33060 138 / 5e-37 NAC ANAC014 NAC 014 (.1.2) AT5G08790 131 / 9e-37 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G35580 135 / 1e-36 NAC NTL9, CBNAC NAC transcription factor-like 9 (.1.2.3) AT3G17730 129 / 3e-36 NAC ANAC057 NAC domain containing protein 57 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G019200 [exp] 392 / 1e-139 AT3G44350 257 / 1e-86 NAC domain containing protein 61 (.1.2) Potri.016G076100 [exp] 244 / 6e-81 AT5G22380 214 / 2e-69 NAC domain containing protein 90 (.1) Potri.006G209200 [exp] 243 / 3e-80 AT5G22380 241 / 3e-80 NAC domain containing protein 90 (.1) Potri.016G076000 [exp] 237 / 4e-78 AT5G22380 226 / 4e-74 NAC domain containing protein 90 (.1) Potri.009G141600 [exp] 144 / 2e-41 AT2G17040 314 / 6e-108 NAC domain containing protein 36 (.1) Potri.003G046700 [exp] 142 / 2e-39 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.008G081500 [exp] 135 / 8e-38 AT1G54330 316 / 1e-107 NAC domain containing protein 20 (.1) Potri.012G007500 [exp] 139 / 1e-37 AT5G24590 306 / 4e-98 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Potri.004G230800 [exp] 136 / 1e-37 AT2G02450 311 / 2e-103 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020643 [exp] 303 / 3e-104 AT5G22380 283 / 1e-96 NAC domain containing protein 90 (.1) Lus10004846 [exp] 298 / 4e-102 AT5G22380 275 / 1e-93 NAC domain containing protein 90 (.1) Lus10029410 [exp] 184 / 3e-57 AT5G22380 171 / 1e-52 NAC domain containing protein 90 (.1) Lus10008420 [exp] 139 / 1e-38 AT2G02450 320 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10022636 [exp] 137 / 1e-38 AT2G17040 287 / 6e-97 NAC domain containing protein 36 (.1) Lus10008419 [exp] 139 / 3e-38 AT2G02450 327 / 7e-109 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10003333 [exp] 136 / 3e-38 AT2G17040 293 / 2e-99 NAC domain containing protein 36 (.1) Lus10003367 [exp] 139 / 7e-38 AT2G02450 333 / 3e-110 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10042731 [exp] 134 / 1e-37 AT1G01720 414 / 7e-147 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10042284 [exp] 133 / 4e-37 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.001G218800.1 pacid=42789569 polypeptide=Potri.001G218800.1.p locus=Potri.001G218800 ID=Potri.001G218800.1.v4.1 annot-version=v4.1 ATGCTTATACAGCTCAGGCTGACAAGGGAACAAGACACAAGAACAAGAACAAGAACAAGAATGGAGGAACTCCCTCTAGGTTACCGCTTCTACCCAACAG AAGAAGAGCTGATCTCCTTCTACCTGCATAATAAGCTGGGAGGGGGGAGGCAAGAACGTCTACAACGTGTTATTCCAGACATCAGCATTTACGACATCGA ACCATGGGATCTTCCAAAGCTTTCAGGAGAACTATGTCAGGGAGACACCGAGCAGTGGTTCTTCTTTACACCCAGGCAAGAGAGAGAAGCGAGGGGAGGG AGACCTAACCGGACTACAGCATCCGGGTACTGGAAGGCCACAGGCTCTCCTGGTTATGTTTACTCGTCGGACAATCGTGTGATTGGATTGAAGAAAACCA TGGTGTTCTATACGGGAAAAGCTCCAAGAGGAAGAAAAACCAAATGGAAGATGAATGAATACAGAGCCATTGAAGTTCATGAATCTTCTAGTAATGCTAC TCCAAAGTTGAGGCATGAATTCAGCTTGTGTCGAGTCTATGTGGTATCAGGAAGCTTTCGTGCATTTGATAGGCGGCCACTAGAAGCTGTGACAAGAGAG ACGCAGCTTCTTGGAGATGGAGCTACAACATCTGCTCAGGGCCCTGATCCAACTGTGGATATGACAAGCTCACCTGAAACGTCATACTCAGTGGAAGACC ATGTTGATCACCCAGGGACTGCAGCAAGTGCCAACTGGGGCTCAGTAGATGGTCTAGAACCACCTGCATGGGAATGGCCAGGACAACTGGATTGGCCCTG A
AA sequence Show only first row Show all	>Potri.001G218800.1 pacid=42789569 polypeptide=Potri.001G218800.1.p locus=Potri.001G218800 ID=Potri.001G218800.1.v4.1 annot-version=v4.1 MLIQLRLTREQDTRTRTRTRMEELPLGYRFYPTEEELISFYLHNKLGGGRQERLQRVIPDISIYDIEPWDLPKLSGELCQGDTEQWFFFTPRQEREARGG RPNRTTASGYWKATGSPGYVYSSDNRVIGLKKTMVFYTGKAPRGRKTKWKMNEYRAIEVHESSSNATPKLRHEFSLCRVYVVSGSFRAFDRRPLEAVTRE TQLLGDGATTSAQGPDPTVDMTSSPETSYSVEDHVDHPGTAASANWGSVDGLEPPAWEWPGQLDWP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Potri.001G218800 [exp]	0	1
AT3G19830		NTMCTYPE5.2 ,NT...	Calcium-dependent lipid-bindin...		Potri.008G085000 [exp]	2.00	0.8599
AT1G49850			RING/U-box superfamily protein...		Potri.009G091200 [exp]	8.12	0.8158
AT5G24590	NAC	TIP, ANAC091	Arabidopsis NAC domain contain...		Potri.012G007500 [exp]	8.36	0.7920
AT4G33920			Protein phosphatase 2C family ...		Potri.001G297200 [exp]	9.16	0.8128
AT5G66210		CPK28	calcium-dependent protein kina...		Potri.005G113600 [exp]	9.79	0.8434	CPK18
AT2G04305			Magnesium transporter CorA-lik...		Potri.001G285300 [exp]	10.19	0.7929
AT4G23810	WRKY	ATWRKY53, WRKY5...	WRKY family transcription fact...		Potri.014G096200 [exp]	10.95	0.8459
AT3G61790			Protein with RING/U-box and TR...		Potri.001G026200 [exp]	11.40	0.7581
AT3G52460			hydroxyproline-rich glycoprote...		Potri.009G020000 [exp]	11.83	0.7696
					Potri.017G077100 [exp]	13.74	0.8107

Compare expression of checked genes

Potri.001G218800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.