Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10230 59 / 9e-12 AtLCY, LYC lycopene cyclase (.1.2) AT5G57030 44 / 2e-06 LUT2 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G197100 [exp] 88 / 9e-22 AT3G10230 533 / 0.0 lycopene cyclase (.1.2) Potri.009G159800 [exp] 84 / 3e-20 AT3G10230 538 / 0.0 lycopene cyclase (.1.2) Potri.006G043092 [exp] 64 / 2e-13 AT3G10230 794 / 0.0 lycopene cyclase (.1.2) Potri.016G040200 [exp] 64 / 3e-13 AT3G10230 770 / 0.0 lycopene cyclase (.1.2) Potri.006G147300 [exp] 40 / 5e-05 AT5G57030 723 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027278 [exp] 64 / 2e-13 AT3G10230 832 / 0.0 lycopene cyclase (.1.2) Lus10038986 [exp] 64 / 2e-13 AT3G10230 831 / 0.0 lycopene cyclase (.1.2) Lus10013298 [exp] 52 / 6e-09 AT3G10230 508 / 3e-177 lycopene cyclase (.1.2) Lus10021576 [exp] 41 / 2e-05 AT5G57030 805 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1) Lus10017156 [exp] 41 / 2e-05 AT5G57030 801 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF05834 [poplar] [flax] Lycopene_cycl Lycopene cyclase protein
Representative CDS sequence Show only first row Show all	>Potri.001G219250.1 pacid=42791479 polypeptide=Potri.001G219250.1.p locus=Potri.001G219250 ID=Potri.001G219250.1.v4.1 annot-version=v4.1 ATGTCTTGTGGACACCACTTTTCATTGTGGCCTAATAACCATGGAATTTGGGTTGATGAGTTTGAGAGCTCTGGGCTTGTAGATTGTTTGGACAAAACAT GGCCTATGACTTATCTCTATATTGATGATCACAAGACCAAGTATTTAGACCATCCTGCTGATAGGTCTAGCTTTGATGTGATCGTTAGTGGCACTGGCCC GGTTGGTCCATATCTCGCCGAACAAGTGTCCCGATATGGAGTTAAGATTGTTTGGACAAAACATGGCCTATGA
AA sequence Show only first row Show all	>Potri.001G219250.1 pacid=42791479 polypeptide=Potri.001G219250.1.p locus=Potri.001G219250 ID=Potri.001G219250.1.v4.1 annot-version=v4.1 MSCGHHFSLWPNNHGIWVDEFESSGLVDCLDKTWPMTYLYIDDHKTKYLDHPADRSSFDVIVSGTGPVGPYLAEQVSRYGVKIVWTKHGL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Potri.001G219250 [exp]	0	1
AT1G01490			Heavy metal transport/detoxifi...		Potri.001G099500 [exp]	2.82	0.8625
					Potri.007G039601 [exp]	3.16	0.8749
					Potri.001G104432 [exp]	4.89	0.7730
AT3G02040		AtGDPD1, SRG3	Glycerophosphodiester phosphod...		Potri.001G061100 [exp]	35.56	0.6832
AT5G65160		TPR14	tetratricopeptide repeat 14, t...		Potri.002G094800 [exp]	37.78	0.7718
AT4G34940		ARO1	armadillo repeat only 1 (.1)		Potri.009G131900 [exp]	46.73	0.6346
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Potri.007G118600 [exp]	51.18	0.7410
					Potri.003G184601 [exp]	51.52	0.7416
AT3G06240			F-box family protein (.1)		Potri.001G318300 [exp]	61.33	0.6232
					Potri.007G014501 [exp]	64.86	0.7385

Compare expression of checked genes

Potri.001G219250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.