Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20030 154 / 2e-46 Pathogenesis-related thaumatin superfamily protein (.1.2) AT1G75800 150 / 1e-44 Pathogenesis-related thaumatin superfamily protein (.1) AT4G38670 141 / 8e-42 Pathogenesis-related thaumatin superfamily protein (.1.2.3) AT1G19320 136 / 5e-40 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75050 135 / 1e-39 Pathogenesis-related thaumatin superfamily protein (.1) AT2G17860 134 / 2e-39 Pathogenesis-related thaumatin superfamily protein (.1) AT4G38660 132 / 1e-37 Pathogenesis-related thaumatin superfamily protein (.1.2) AT4G36010 130 / 3e-37 Pathogenesis-related thaumatin superfamily protein (.1.2) AT1G75030 125 / 1e-35 ATLP-3 thaumatin-like protein 3 (.1) AT4G24180 121 / 3e-34 ATTLP1 THAUMATIN-LIKE PROTEIN 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G220900 [exp] 201 / 2e-65 AT1G20030 251 / 2e-83 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.002G020500 [exp] 157 / 3e-47 AT1G75800 404 / 7e-142 Pathogenesis-related thaumatin superfamily protein (.1) Potri.005G240900 [exp] 155 / 1e-46 AT1G75800 398 / 7e-140 Pathogenesis-related thaumatin superfamily protein (.1) Potri.004G014574 [exp] 147 / 4e-44 AT1G75800 294 / 8e-100 Pathogenesis-related thaumatin superfamily protein (.1) Potri.005G112600 [exp] 140 / 8e-41 AT4G38660 348 / 2e-119 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.004G173200 [exp] 139 / 3e-40 AT4G38660 357 / 5e-123 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.005G112700 [exp] 137 / 7e-40 AT4G36010 372 / 3e-130 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.009G132500 [exp] 137 / 2e-39 AT4G38660 338 / 3e-115 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.009G132200 [exp] 135 / 6e-39 AT4G38670 410 / 2e-145 Pathogenesis-related thaumatin superfamily protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023897 [exp] 169 / 6e-53 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1) Lus10004410 [exp] 161 / 1e-49 AT1G20030 252 / 1e-83 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10033136 [exp] 152 / 2e-45 AT1G75800 375 / 8e-131 Pathogenesis-related thaumatin superfamily protein (.1) Lus10034534 [exp] 151 / 4e-45 AT1G75800 376 / 5e-131 Pathogenesis-related thaumatin superfamily protein (.1) Lus10017265 [exp] 151 / 5e-45 AT1G75800 390 / 2e-136 Pathogenesis-related thaumatin superfamily protein (.1) Lus10028448 [exp] 146 / 2e-43 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10041901 [exp] 142 / 8e-42 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10028447 [exp] 138 / 5e-40 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10041899 [exp] 134 / 2e-38 AT4G38660 363 / 2e-125 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10025055 [exp] 126 / 8e-36 AT4G38660 359 / 6e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0293 [poplar] [flax] CDC PF00314 [poplar] [flax] Thaumatin Thaumatin family
Representative CDS sequence Show only first row Show all	>Potri.001G221300.2 pacid=42793566 polypeptide=Potri.001G221300.2.p locus=Potri.001G221300 ID=Potri.001G221300.2.v4.1 annot-version=v4.1 ATGCAGGAGCTTAACTTTCGTCGTCAAAAACAACTGTCCATACACAGTCTGGCCAGGAACTCTAACGGCTGCTGGCCGTCCGACTATATCTTCAACTGGC TTCACATTGGCAACAGGTGCTTCACCTTCGCTAAGTGTCCCTGCAACATGGTCTGGCGCTTGTGGGCAAGAACACAATGCTCTACACATTCCTCAGGAAA GTTTGTTTGTGCTACTGCTGACTGTGCCTCTGGTGTCATAGAATGCAATGGAGCCGGTGCGATCCCACCAGCATCCTTGGCAGAATTCACTCTAAGAGGT GATGGTGGGCAAGATTATTACGATATAAGCCTTGTTGATGGCTTTAACATCCCAATTTTGGTAACCCCGCAAGGACGTTCTACTGGCTGCCGTTCTACAA GCTGTGCACCTGACGTGAATGCTGTTTGTGATCCTAGTTTAGCAGTGAGAAGGCCAGATGGGACTGTGATTGCCTGCAAGAGTGCGAATTTGGCATTTAA CCAGCCGCAGTTCTGCTGCTCAGGAGAGTATAATACACCTGACATATAG
AA sequence Show only first row Show all	>Potri.001G221300.2 pacid=42793566 polypeptide=Potri.001G221300.2.p locus=Potri.001G221300 ID=Potri.001G221300.2.v4.1 annot-version=v4.1 MQELNFRRQKQLSIHSLARNSNGCWPSDYIFNWLHIGNRCFTFAKCPCNMVWRLWARTQCSTHSSGKFVCATADCASGVIECNGAGAIPPASLAEFTLRG DGGQDYYDISLVDGFNIPILVTPQGRSTGCRSTSCAPDVNAVCDPSLAVRRPDGTVIACKSANLAFNQPQFCCSGEYNTPDI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G221300 [exp]	0	1
AT4G23290		CRK21	cysteine-rich RLK (RECEPTOR-li...		Potri.018G111751 [exp]	3.16	0.9361
AT3G51970		ATASAT1, ASAT1,...	ARABIDOPSIS THALIANA STEROL O-...		Potri.006G009800 [exp]	6.00	0.9272
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G222100 [exp]	13.60	0.8851
					Potri.017G095500 [exp]	14.49	0.8859
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.018G111600 [exp]	14.73	0.9143
AT4G27290			S-locus lectin protein kinase ...		Potri.011G125151 [exp]	16.06	0.9156
AT1G13820			alpha/beta-Hydrolases superfam...		Potri.010G158800 [exp]	17.88	0.9158
AT1G32080		AtLrgB	membrane protein, putative (.1...		Potri.003G099600 [exp]	18.54	0.9250
AT5G08280		HEMC	hydroxymethylbilane synthase (...		Potri.005G091600 [exp]	21.02	0.9060
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.003G211932 [exp]	21.63	0.8976

Compare expression of checked genes

Potri.001G221300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.