Potri.001G221700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75800 273 / 1e-91 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G20030 272 / 1e-91 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT4G38670 254 / 8e-85 Pathogenesis-related thaumatin superfamily protein (.1.2.3)
AT4G38660 253 / 7e-84 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT2G17860 249 / 2e-83 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75050 244 / 1e-81 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75040 243 / 4e-81 PR-5, PR5 pathogenesis-related gene 5 (.1)
AT4G36010 241 / 9e-80 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G19320 234 / 9e-78 Pathogenesis-related thaumatin superfamily protein (.1)
AT5G38280 246 / 1e-77 PR5K PR5-like receptor kinase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G221500 435 / 8e-157 AT1G75800 269 / 6e-90 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221900 428 / 5e-154 AT1G75800 271 / 5e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G284305 426 / 2e-153 AT1G75800 270 / 3e-90 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221800 426 / 3e-153 AT1G75800 272 / 2e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221100 421 / 4e-151 AT1G75800 277 / 2e-93 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221200 418 / 3e-150 AT1G75800 254 / 2e-84 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G222100 414 / 2e-148 AT1G75800 283 / 2e-95 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221400 405 / 3e-145 AT1G75800 260 / 1e-86 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G220900 355 / 4e-125 AT1G20030 251 / 2e-83 Pathogenesis-related thaumatin superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023897 306 / 7e-106 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10004410 269 / 3e-91 AT1G20030 252 / 1e-83 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10017265 271 / 5e-91 AT1G75800 390 / 2e-136 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10034534 270 / 1e-90 AT1G75800 376 / 5e-131 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10033136 267 / 2e-89 AT1G75800 375 / 8e-131 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10028448 265 / 4e-89 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041901 256 / 1e-85 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041899 243 / 1e-79 AT4G38660 363 / 2e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10028447 242 / 1e-79 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10032726 238 / 7e-79 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Potri.001G221700.1 pacid=42792316 polypeptide=Potri.001G221700.1.p locus=Potri.001G221700 ID=Potri.001G221700.1.v4.1 annot-version=v4.1
ATGAGTGCAGGTCATTGCATGGACGGTCTGCGCACTTCAGGAGCTCAATCTGTGACTTTCGTCTTCACAAACAACTGTCCATACACAGTCTGGCCAGGAA
CTCTAACGGCTGCTGGCGGTCCGTCTTTATCTTCAACTGGCTTCACATTGGCAACGGGTGCTTCATCTTCGCTGAGTGTCCCTGTCAATTGGTCTGGCCG
CTTGTGGGCCAGAACGCAATGCTCTACAGATGCCTCGGGAAAGTTTGTTTGTGCTACTGCTGACTGTGCCTCTGGTGTCATAGAATGCAATGGAGCCGGT
GCGATCCCACCAGCATCGTTAGCAGAATTTACTCTAAGAGGTGATGGTGGGAAAGATTTTTACGATATAAGCCTTGTTGATGGCTTTAACATCCCAATTT
CGGTAACCCCGCAAGGAGGTTCTACTGGCTGCCCTTCTACAAGCTGTGCAGCTAACGTGAATGCTGCTTGTGATCCTAGTTTAGCAGTGAGAGGTTCAGA
TGGGACTGTGATTGCCTGCAAGAGCGCGTGTTTGGCATTTAACCAGCCGCAGTTCTGCTGCACAGGAGAGTATGATTCACCTGAAAAATGTCAACCTAAC
CAATATTCGATGACTTTCAAGCAGCAGTGTCCTCAAGCTTATAGTTATGCTTATGATGATAAATCGAGCACGTTTACTTGTCCTAGCGGAGGCAACTATT
TGATTACCTTTTGTCCATGA
AA sequence
>Potri.001G221700.1 pacid=42792316 polypeptide=Potri.001G221700.1.p locus=Potri.001G221700 ID=Potri.001G221700.1.v4.1 annot-version=v4.1
MSAGHCMDGLRTSGAQSVTFVFTNNCPYTVWPGTLTAAGGPSLSSTGFTLATGASSSLSVPVNWSGRLWARTQCSTDASGKFVCATADCASGVIECNGAG
AIPPASLAEFTLRGDGGKDFYDISLVDGFNIPISVTPQGGSTGCPSTSCAANVNAACDPSLAVRGSDGTVIACKSACLAFNQPQFCCTGEYDSPEKCQPN
QYSMTFKQQCPQAYSYAYDDKSSTFTCPSGGNYLITFCP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G75800 Pathogenesis-related thaumatin... Potri.001G221700 0 1
AT1G75800 Pathogenesis-related thaumatin... Potri.001G221500 1.41 0.9676
AT1G75800 Pathogenesis-related thaumatin... Potri.001G222100 2.00 0.9438
AT3G47570 Leucine-rich repeat protein ki... Potri.015G037400 2.23 0.9345
AT1G75800 Pathogenesis-related thaumatin... Potri.001G284305 2.44 0.9605
AT1G75800 Pathogenesis-related thaumatin... Potri.001G221800 3.00 0.9457
AT5G22510 INV-E, At-A/N-I... Arabidopsis alkaline/neutral i... Potri.008G024100 3.00 0.8923
AT5G58660 2-oxoglutarate (2OG) and Fe(II... Potri.001G278200 6.00 0.9275
AT1G66920 Protein kinase superfamily pro... Potri.017G035500 7.07 0.8920
AT1G05010 ACO4, EAT1, EFE ethylene forming enzyme, ethyl... Potri.014G159000 9.53 0.9237 Pt-ACO1.4
AT2G19130 S-locus lectin protein kinase ... Potri.013G149500 10.19 0.9152

Potri.001G221700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.