Potri.001G225300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37290 305 / 1e-107 ARM repeat superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013386 296 / 4e-104 AT5G37290 286 / 2e-100 ARM repeat superfamily protein (.1.2)
Lus10008435 196 / 5e-61 AT5G37290 184 / 6e-56 ARM repeat superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.001G225300.1 pacid=42788752 polypeptide=Potri.001G225300.1.p locus=Potri.001G225300 ID=Potri.001G225300.1.v4.1 annot-version=v4.1
ATGTTTACAAATAATCAAAGACAAGAAGAAAGAACCGGAAAATATGGAACCCCAAGACTCCAATACCTTCAGGAGTTGGTGAACCAGTTTCAGAATGCAG
CGGATGAAGAAAGAAAAGAGAGGATAGTTGCTAACTTGGCAAACTTTGCTTATGATCCTTATAACTATACATTCTTGCGTCAGCTAAATGTTTTGGAGCT
ATTCCTTGATTGCATAACAGAACCAAATGAGAAGCTTGTCGAATTTGGTATTGGAGGAATATGCAATTCTTGTGTTGATCCAGCAAATGCTGCTATCATC
ACTCAGTCCGGAGGCATACCCCTCACTATCCAATGTTTATCAAGCCCAGTAAGAAACACTGTTAATTATGCTCTTGGATCTCTTTATTATCTCTGTAACT
CATCTACCAAGGAAGAGATTCTAAAGCCAGAAGTTTTAGATGTTATCAAGAGGTATGCTGCTTGTGAAACAGTAAATGTAAGCTTCAGTAATCTGGCTAA
AGCTTTCTTAGACAAGCATGTGTATGAAAACAAGTGA
AA sequence
>Potri.001G225300.1 pacid=42788752 polypeptide=Potri.001G225300.1.p locus=Potri.001G225300 ID=Potri.001G225300.1.v4.1 annot-version=v4.1
MFTNNQRQEERTGKYGTPRLQYLQELVNQFQNAADEERKERIVANLANFAYDPYNYTFLRQLNVLELFLDCITEPNEKLVEFGIGGICNSCVDPANAAII
TQSGGIPLTIQCLSSPVRNTVNYALGSLYYLCNSSTKEEILKPEVLDVIKRYAACETVNVSFSNLAKAFLDKHVYENK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G37290 ARM repeat superfamily protein... Potri.001G225300 0 1
AT5G17610 unknown protein Potri.013G073100 2.82 0.8683
AT4G20380 LSD1 LESION SIMULATING DISEASE, LSD... Potri.001G442400 3.46 0.8602 LSD1.1
Potri.010G139550 3.46 0.8872
Potri.017G149301 4.47 0.8908
AT2G27110 FAR1_related FRS3 FAR1-related sequence 3 (.1.2.... Potri.012G097200 5.29 0.8837
Potri.017G145400 8.30 0.8971
AT4G35785 RNA-binding (RRM/RBD/RNP motif... Potri.003G130301 8.48 0.8475
AT5G67140 F-box/RNI-like superfamily pro... Potri.005G140000 10.95 0.8160
AT1G16250 Galactose oxidase/kelch repeat... Potri.010G004500 11.57 0.7911
AT1G05060 unknown protein Potri.014G156700 13.63 0.7947

Potri.001G225300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.