Potri.001G226600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27350 104 / 5e-27 SFP1 Major facilitator superfamily protein (.1)
AT5G27360 97 / 2e-24 SFP2 Major facilitator superfamily protein (.1)
AT2G48020 96 / 5e-24 Major facilitator superfamily protein (.1.2)
AT1G54730 91 / 2e-22 Major facilitator superfamily protein (.1.2.3)
AT1G08890 89 / 1e-21 Major facilitator superfamily protein (.1)
AT1G08930 89 / 1e-21 ERD6 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
AT3G20460 87 / 6e-21 Major facilitator superfamily protein (.1)
AT3G05160 87 / 7e-21 Major facilitator superfamily protein (.1.2)
AT3G05400 86 / 1e-20 Major facilitator superfamily protein (.1.2)
AT3G05165 86 / 3e-20 Major facilitator superfamily protein (.1.2.3.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G027800 214 / 1e-68 AT5G27360 405 / 6e-138 Major facilitator superfamily protein (.1)
Potri.005G037000 114 / 1e-30 AT1G08920 483 / 3e-168 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Potri.013G027700 112 / 9e-30 AT1G08930 483 / 6e-168 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
Potri.005G039900 111 / 1e-29 AT1G08920 461 / 1e-159 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Potri.013G027500 100 / 2e-25 AT1G54730 606 / 0.0 Major facilitator superfamily protein (.1.2.3)
Potri.005G040000 93 / 7e-23 AT1G54730 429 / 2e-147 Major facilitator superfamily protein (.1.2.3)
Potri.014G136600 90 / 9e-22 AT2G48020 665 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.002G212900 90 / 9e-22 AT2G48020 723 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.010G026500 86 / 2e-20 AT5G18840 686 / 0.0 Major facilitator superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033812 120 / 7e-33 AT1G08930 499 / 1e-174 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
Lus10035354 99 / 8e-25 AT1G54730 615 / 0.0 Major facilitator superfamily protein (.1.2.3)
Lus10029966 95 / 2e-23 AT1G54730 525 / 0.0 Major facilitator superfamily protein (.1.2.3)
Lus10029965 94 / 2e-23 AT4G04750 283 / 2e-92 Major facilitator superfamily protein (.1)
Lus10033814 94 / 5e-23 AT1G08920 466 / 8e-162 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Lus10002258 91 / 4e-22 AT1G54730 319 / 2e-101 Major facilitator superfamily protein (.1.2.3)
Lus10000924 90 / 1e-21 AT4G04750 371 / 1e-124 Major facilitator superfamily protein (.1)
Lus10008183 89 / 2e-21 AT2G48020 657 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10008179 88 / 4e-21 AT2G48020 590 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10027976 87 / 9e-21 AT2G48020 598 / 0.0 Major facilitator superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00083 Sugar_tr Sugar (and other) transporter
Representative CDS sequence
>Potri.001G226600.2 pacid=42788484 polypeptide=Potri.001G226600.2.p locus=Potri.001G226600 ID=Potri.001G226600.2.v4.1 annot-version=v4.1
ATGAACTGTTCTGGCCTCTTGGTAGTTTTTTTCCTTGGAAACTTTTTTTCATGGCGCACCGTGTCTCTATTAGCTATAATTCCATGTTTAATGCAAGTTG
TCGGTTTAGTCTTCATACCAGAGTCTCCAAGATGGCTAGCATCAATTGGCAAGGAAATAGAGTTTGAAGATGCTTTGCGACGGCTTAGAGGAGTGGATGC
CGGTTTTTCTCAAGAAGCTATTGAAATCAAAGATGCTACAGAGAATTTCCAACGCAGTGAAGCTGGATTTCAAGGCTTGTTTCAAAAGAAATATGCTTAT
CCAGTTATGATTGGAGTAGGGTTAATGTTACTTCAACAATTGGGAGGGAACAGTGTGTTTGCAGCTTATCTTAGCACAGTGTTTGCTAAAGCTAGTAAGT
CTCTCTCTTAA
AA sequence
>Potri.001G226600.2 pacid=42788484 polypeptide=Potri.001G226600.2.p locus=Potri.001G226600 ID=Potri.001G226600.2.v4.1 annot-version=v4.1
MNCSGLLVVFFLGNFFSWRTVSLLAIIPCLMQVVGLVFIPESPRWLASIGKEIEFEDALRRLRGVDAGFSQEAIEIKDATENFQRSEAGFQGLFQKKYAY
PVMIGVGLMLLQQLGGNSVFAAYLSTVFAKASKSLS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G27350 SFP1 Major facilitator superfamily ... Potri.001G226600 0 1
AT5G27360 SFP2 Major facilitator superfamily ... Potri.013G027800 1.00 0.8555
AT4G34240 ALDH3I1 aldehyde dehydrogenase 3I1 (.1... Potri.005G069800 6.00 0.6747
AT2G40410 Staphylococcal nuclease homolo... Potri.010G182500 10.00 0.6589
AT1G20480 AMP-dependent synthetase and l... Potri.003G210701 19.59 0.6425
AT1G20480 AMP-dependent synthetase and l... Potri.003G210600 36.74 0.5917
AT3G06880 Transducin/WD40 repeat-like su... Potri.002G021600 48.10 0.6308
AT3G12380 ATARP5 actin-related protein 5 (.1.2) Potri.010G202000 52.99 0.6128 ARP909
AT3G26610 Pectin lyase-like superfamily ... Potri.010G044001 55.82 0.5489
AT3G18670 Ankyrin repeat family protein ... Potri.011G015750 57.48 0.6267
AT5G13460 IQD11 IQ-domain 11 (.1) Potri.001G021000 64.21 0.6240

Potri.001G226600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.