Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45140 72 / 1e-16 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) AT1G72520 49 / 2e-08 ATLOX4, LOX4 Arabidopsis thaliana lipoxygenase 4, PLAT/LH2 domain-containing lipoxygenase family protein (.1) AT1G17420 47 / 9e-08 ATLOX3, LOX3 Arabidopsis thaliana lipoxygenase 3, lipoxygenase 3 (.1) AT1G67560 47 / 1e-07 ATLOX6, LOX6 Arabidopsis thaliana lipoxygenase 6, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G022400 [exp] 94 / 3e-24 AT3G45140 1008 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.017G046200 [exp] 83 / 3e-20 AT3G45140 979 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.001G015500 [exp] 82 / 7e-20 AT3G45140 975 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.001G015400 [exp] 77 / 3e-18 AT3G45140 990 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.001G015300 [exp] 63 / 4e-13 AT3G45140 943 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Potri.001G167700 [exp] 52 / 3e-09 AT1G17420 1444 / 0.0 Arabidopsis thaliana lipoxygenase 3, lipoxygenase 3 (.1) Potri.003G067600 [exp] 50 / 1e-08 AT1G17420 1000 / 0.0 Arabidopsis thaliana lipoxygenase 3, lipoxygenase 3 (.1) Potri.010G057100 [exp] 46 / 3e-07 AT1G67560 1144 / 0.0 Arabidopsis thaliana lipoxygenase 6, PLAT/LH2 domain-containing lipoxygenase family protein (.1) Potri.008G178000 [exp] 45 / 6e-07 AT1G67560 1155 / 0.0 Arabidopsis thaliana lipoxygenase 6, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002547 [exp] 82 / 9e-20 AT3G45140 971 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10027379 [exp] 82 / 9e-20 AT1G72520 867 / 0.0 Arabidopsis thaliana lipoxygenase 4, PLAT/LH2 domain-containing lipoxygenase family protein (.1) Lus10002545 [exp] 74 / 4e-17 AT3G45140 991 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10041646 [exp] 72 / 3e-16 AT3G45140 939 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10031236 [exp] 67 / 9e-15 AT3G45140 805 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10031809 [exp] 67 / 2e-14 AT3G45140 753 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10031237 [exp] 64 / 2e-13 AT3G45140 442 / 3e-149 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10039094 [exp] 63 / 3e-13 AT3G45140 946 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10032087 [exp] 60 / 4e-12 AT3G45140 894 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1) Lus10035232 [exp] 58 / 2e-11 AT3G45140 584 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00305 [poplar] [flax] Lipoxygenase Lipoxygenase
Representative CDS sequence Show only first row Show all	>Potri.001G226904.1 pacid=42792545 polypeptide=Potri.001G226904.1.p locus=Potri.001G226904 ID=Potri.001G226904.1.v4.1 annot-version=v4.1 ATGCCAACCGAGGCCGCGCCATTAGATGAGGAGTTGAAGCTCTTCTTGATGAAACCAGGATTTGCCTTGTTAAAATACTTTCCATCACAGATTCAAGCAA GGAAAGTGATGACTGTTTTGGATGTTATATCTAGCCATTCACCTGATGAGGAGTGCATTGGTGAGCAAATGGAGCCGTCGTGGGAAGAGAATCCGTCATT AGGGCTGCCTTTGAAAGGTTTAATGCAAGACTGA
AA sequence Show only first row Show all	>Potri.001G226904.1 pacid=42792545 polypeptide=Potri.001G226904.1.p locus=Potri.001G226904 ID=Potri.001G226904.1.v4.1 annot-version=v4.1 MPTEAAPLDEELKLFLMKPGFALLKYFPSQIQARKVMTVLDVISSHSPDEECIGEQMEPSWEENPSLGLPLKGLMQD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.001G226904 [exp]	0	1
AT2G23090			Uncharacterised protein family...		Potri.014G018400 [exp]	2.82	0.8981
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Potri.003G066300 [exp]	3.16	0.9040
AT2G41760			unknown protein		Potri.006G051500 [exp]	6.70	0.9014
AT1G53400			Ubiquitin domain-containing pr...		Potri.001G387400 [exp]	7.48	0.8641
AT5G38560		AtPERK8	proline-rich extensin-like rec...		Potri.004G105200 [exp]	11.31	0.8631
					Potri.001G054200 [exp]	12.48	0.8112
AT4G30420			nodulin MtN21 /EamA-like trans...		Potri.006G177600 [exp]	13.07	0.8764
AT5G01980			RING/U-box superfamily protein...		Potri.016G141600 [exp]	13.19	0.8855
					Potri.012G059801 [exp]	13.85	0.8561
AT3G11470			4'-phosphopantetheinyl transfe...		Potri.006G211300 [exp]	16.49	0.8617

Compare expression of checked genes

Potri.001G226904 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.