Plant FIBer expression Database

Potri.001G230100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44360 158 / 5e-51 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012711
[exp]
152 / 2e-48 AT2G44360 177 / 1e-58 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G230100.1 pacid=42789797 polypeptide=Potri.001G230100.1.p locus=Potri.001G230100 ID=Potri.001G230100.1.v4.1 annot-version=v4.1
ATGGCAGAAGAAGGGAAATCAGATGCACAGCTCTTTCAGCTCCTCTCCAATCTCCTCCAACAAGTGGAAGCGCAATCAAACGAGGAAGAAGTTGAGCTGC
GCTCCAAAATTGAAGCACTTGGATTGGAGGTTGCAAAACTTCCATCAAAGTCGACAAATAATCTTGATGAGCTGGAAATAGCGAGAGAGTTGGATAAATT
ATCAGCCAAGTTAGATGATGTGGATGAAATGATATCCTCGGCTCTGGCTTCAGATCCACAGGTGCAGTCACTCTTAAGTGACACTGCTGATGTATGGATG
CCAGTTATTACTGCTAACGCTGATGAACGTCGGAATTTTACTGCATCAGTTGGCAATGATAAATCCGAAGAGAAAGGAGAAAATCCCAAATAA
AA sequence
>Potri.001G230100.1 pacid=42789797 polypeptide=Potri.001G230100.1.p locus=Potri.001G230100 ID=Potri.001G230100.1.v4.1 annot-version=v4.1
MAEEGKSDAQLFQLLSNLLQQVEAQSNEEEVELRSKIEALGLEVAKLPSKSTNNLDELEIARELDKLSAKLDDVDEMISSALASDPQVQSLLSDTADVWM
PVITANADERRNFTASVGNDKSEEKGENPK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G44360 unknown protein Potri.001G230100
[exp]
0 1
AT4G34720 ATVHA-C1, AVA-P... VACUOLAR H+-PUMPING ATPASE C1,... Potri.009G125000
[exp]
2.82 0.8635 Pt-AVAP5.2
AT3G03070 NADH-ubiquinone oxidoreductase... Potri.013G082100
[exp]
4.69 0.8584
AT2G25310 Protein of unknown function (D... Potri.018G024600
[exp]
6.92 0.8463
AT5G43430 ETFBETA electron transfer flavoprotein... Potri.008G165800
[exp]
10.09 0.7881
AT5G53300 UBC10 ubiquitin-conjugating enzyme 1... Potri.012G033000
[exp]
11.18 0.8143 UBC9.1
AT1G30540 Actin-like ATPase superfamily ... Potri.001G466900
[exp]
11.44 0.7522
AT1G51200 A20/AN1-like zinc finger famil... Potri.016G051700
[exp]
13.11 0.7946
AT4G13360 ATP-dependent caseinolytic (Cl... Potri.006G155700
[exp]
14.14 0.7970
AT2G39780 RNS2 ribonuclease 2 (.1.2) Potri.014G174400
[exp]
14.89 0.8562
AT4G16566 HINT4 histidine triad nucleotide-bin... Potri.003G076400
[exp]
15.96 0.8392

Potri.001G230100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.