Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60080 99 / 8e-25 RING/U-box superfamily protein (.1) AT3G56580 81 / 2e-18 RING/U-box superfamily protein (.1.2.3) AT2G39720 79 / 2e-17 RHC2A RING-H2 finger C2A (.1) AT3G19950 78 / 3e-17 RING/U-box superfamily protein (.1) AT5G64920 78 / 3e-17 CIP8 COP1-interacting protein 8 (.1) AT2G40830 77 / 9e-17 RHC1A RING-H2 finger C1A (.1.2.3) AT2G44330 73 / 2e-16 RING/U-box superfamily protein (.1) AT3G46620 75 / 7e-16 zinc finger (C3HC4-type RING finger) family protein (.1) AT3G10815 72 / 1e-15 RING/U-box superfamily protein (.1) AT1G55530 73 / 2e-15 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G036700 [exp] 84 / 4e-19 AT3G19950 273 / 5e-90 RING/U-box superfamily protein (.1) Potri.015G028400 [exp] 81 / 5e-18 AT3G19950 256 / 2e-83 RING/U-box superfamily protein (.1) Potri.016G029300 [exp] 80 / 5e-18 AT2G40830 317 / 9e-108 RING-H2 finger C1A (.1.2.3) Potri.006G032100 [exp] 80 / 5e-18 AT2G40830 327 / 1e-111 RING-H2 finger C1A (.1.2.3) Potri.006G087800 [exp] 79 / 9e-18 AT5G59550 258 / 1e-83 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.007G074014 [exp] 78 / 2e-17 AT3G19950 278 / 5e-93 RING/U-box superfamily protein (.1) Potri.005G090500 [exp] 77 / 4e-17 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1) Potri.016G141600 [exp] 73 / 2e-15 AT5G01980 226 / 1e-69 RING/U-box superfamily protein (.1) Potri.006G112100 [exp] 73 / 4e-15 AT5G01980 293 / 1e-92 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010179 [exp] 84 / 1e-19 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1) Lus10000023 [exp] 80 / 1e-18 AT5G59550 159 / 5e-47 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10024372 [exp] 81 / 3e-18 AT5G59550 197 / 5e-60 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10013235 [exp] 81 / 3e-18 AT2G40830 334 / 7e-115 RING-H2 finger C1A (.1.2.3) Lus10040278 [exp] 80 / 4e-18 AT5G59550 224 / 2e-71 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10030755 [exp] 80 / 5e-18 AT2G40830 336 / 2e-115 RING-H2 finger C1A (.1.2.3) Lus10003698 [exp] 80 / 5e-18 AT2G40830 263 / 5e-87 RING-H2 finger C1A (.1.2.3) Lus10017383 [exp] 76 / 6e-18 AT3G19950 127 / 8e-37 RING/U-box superfamily protein (.1) Lus10001582 [exp] 78 / 7e-18 AT2G40830 178 / 2e-55 RING-H2 finger C1A (.1.2.3) Lus10004712 [exp] 79 / 2e-17 AT5G59550 294 / 6e-97 zinc finger (C3HC4-type RING finger) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain CL0167 [poplar] [flax] Zn_Beta_Ribbon PF14369 [poplar] [flax] zinc_ribbon_9 zinc-ribbon
Representative CDS sequence Show only first row Show all	>Potri.001G231000.3 pacid=42793366 polypeptide=Potri.001G231000.3.p locus=Potri.001G231000 ID=Potri.001G231000.3.v4.1 annot-version=v4.1 ATGTCTTCCACCCCAACAAATGAATGGCAAACCTACTGGTGTCATGAATGTGACCTCAGCATCCACCTTCTCACCACCACCACTCCTCTTTGCCCTCACT GCCACCATGACTTTCTTGAACTCATGGACCCCATTCCCACCTCCACCGCCGCTGACACCACCACTTTCCTCCTTGACAGCCCCTCCTTCCTCAACTTCCT TCAACATCTCAACACCAATAGCCATTGCGATTGTGAAGATGATAATATAAACGCCACTATTGACTCTATCATCCCCACCATAAAAATCACTTCTTGCATG CTAGAAATGGATCCAATGCTTGTGTGTGCAGTGTGTAAAGATCAGTTCTTGATTGATGTTGAGGCCAAGCAGCTGCCCTGCAGTCACTTGTACCATCCAG GCTGCATTCTCCCCTGGCTTTCTAACCACAACTCTTGTCCTCTCTGTCGCTTCCAGTTACAAACGCCAGTAGTCAGAGAGGAGAATTTGGAAAATTGGTC TCCTGATCATCCTCATCATGATGCTAATCATGCTCATGTCGGGGTTTTGTCCACCTCTCTTCCTCCACACTTTTGGTAA
AA sequence Show only first row Show all	>Potri.001G231000.3 pacid=42793366 polypeptide=Potri.001G231000.3.p locus=Potri.001G231000 ID=Potri.001G231000.3.v4.1 annot-version=v4.1 MSSTPTNEWQTYWCHECDLSIHLLTTTTPLCPHCHHDFLELMDPIPTSTAADTTTFLLDSPSFLNFLQHLNTNSHCDCEDDNINATIDSIIPTIKITSCM LEMDPMLVCAVCKDQFLIDVEAKQLPCSHLYHPGCILPWLSNHNSCPLCRFQLQTPVVREENLENWSPDHPHHDANHAHVGVLSTSLPPHFW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60080			RING/U-box superfamily protein...		Potri.001G231000 [exp]	0	1
AT4G10840			Tetratricopeptide repeat (TPR)...		Potri.003G143200 [exp]	2.64	0.9271
AT1G13635			DNA glycosylase superfamily pr...		Potri.010G137300 [exp]	2.82	0.9104
AT2G30933			Carbohydrate-binding X8 domain...		Potri.002G059600 [exp]	4.24	0.8913
AT4G22570		APT3	adenine phosphoribosyl transfe...		Potri.001G121400 [exp]	5.29	0.8593	MTN30.1
					Potri.006G181966 [exp]	6.40	0.8506
AT3G03690		UNE7	unfertilized embryo sac 7, Cor...		Potri.013G066200 [exp]	6.92	0.8987
AT5G60720			Protein of unknown function, D...		Potri.009G009500 [exp]	8.30	0.9024
AT5G56040			Leucine-rich receptor-like pro...		Potri.012G088100 [exp]	10.39	0.8730
AT5G45970		ATRAC2, ATROP7,...	RHO-RELATED PROTEIN FROM PLANT...		Potri.011G061500 [exp]	10.48	0.8992	ARAC2.1
AT4G10840			Tetratricopeptide repeat (TPR)...		Potri.001G087800 [exp]	10.95	0.8916

Compare expression of checked genes

Potri.001G231000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.