Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G19875 69 / 7e-16 unknown protein AT2G31940 69 / 8e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G024500 [exp] 110 / 6e-32 AT2G31940 96 / 2e-26 unknown protein Potri.003G216100 [exp] 61 / 6e-13 AT5G19875 86 / 1e-22 unknown protein Potri.001G009200 [exp] 51 / 6e-09 AT5G19875 72 / 5e-17 unknown protein Potri.003G216000 [exp] 43 / 4e-06 AT5G19875 44 / 1e-06 unknown protein Potri.001G009300 [exp] 39 / 0.0002 AT5G19875 51 / 3e-09 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024507 [exp] 69 / 1e-15 AT5G19875 104 / 8e-30 unknown protein Lus10006311 [exp] 61 / 1e-12 AT5G19875 83 / 3e-21 unknown protein Lus10008006 [exp] 57 / 4e-11 AT5G19875 90 / 7e-24 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G231300.1 pacid=42788427 polypeptide=Potri.001G231300.1.p locus=Potri.001G231300 ID=Potri.001G231300.1.v4.1 annot-version=v4.1 ATGGGTAATAGTTATTCATCGTCATCTTATAACTCTCATCCTCCATTACCGATACACCTTTGCTTTTTCCTGCTTATTCTGCTAATGTTCATTGGTTTAA CTTGGTACATCAAATATGAGCCGGTGTTAGAGGGCATGTTTGATCAAGGGAAGCTGATTCTAATGGCGTCTCCCTTGCTGCTTTTGCTACTTGTTCATTG GTTTTCGAATGATGATCATCAATATGGCAGGAGGCTTTCCTATTACCTTCCCTTTCCAGAGAAAGACTCTCTACATAGAGCTGGAGGAACTCCTTGGGGA GTCGGGTTTCTGCTTGTTTTTCTCTTCTTCCTGATCTCTTACCACTCTTATTTCCAAGAGCGTTGGTTTCCTCTTTTAAGCAGATCATAA
AA sequence Show only first row Show all	>Potri.001G231300.1 pacid=42788427 polypeptide=Potri.001G231300.1.p locus=Potri.001G231300 ID=Potri.001G231300.1.v4.1 annot-version=v4.1 MGNSYSSSSYNSHPPLPIHLCFFLLILLMFIGLTWYIKYEPVLEGMFDQGKLILMASPLLLLLLVHWFSNDDHQYGRRLSYYLPFPEKDSLHRAGGTPWG VGFLLVFLFFLISYHSYFQERWFPLLSRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G19875			unknown protein		Potri.001G231300 [exp]	0	1
AT4G34740		CIA1, ATASE2, A...	CHLOROPLAST IMPORT APPARATUS 1...		Potri.009G125600 [exp]	1.00	0.9849
AT5G13770			Pentatricopeptide repeat (PPR-...		Potri.008G142900 [exp]	1.73	0.9834
AT4G17090		CT-BMY, BMY8, B...	BETA-AMYLASE 8, BETA-AMYLASE 3...		Potri.003G085500 [exp]	2.00	0.9829	Pt-BMY.2
AT5G24120		ATSIG5, SIG5, S...	SIGMA FACTOR 5, sigma factor E...		Potri.012G031100 [exp]	2.00	0.9846	Pt-SIGE.3
AT1G60470		ATGOLS4	galactinol synthase 4 (.1)		Potri.010G042000 [exp]	4.89	0.9670
AT1G64500			Glutaredoxin family protein (....		Potri.003G141800 [exp]	5.00	0.9777
AT4G10270			Wound-responsive family protei...		Potri.001G408100 [exp]	5.65	0.9652
AT5G14570		ATNRT2.7	high affinity nitrate transpor...		Potri.001G348300 [exp]	5.74	0.9625
AT1G07010		AtSLP1	Shewenella-like protein phosph...		Potri.009G077900 [exp]	8.48	0.9647
AT2G17350			unknown protein		Potri.009G169200 [exp]	9.79	0.9313

Compare expression of checked genes

Potri.001G231300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.