Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44290 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 178 / 8e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 135 / 5e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G58550 115 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 69 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 64 / 7e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 62 / 4e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 61 / 8e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G27950 61 / 1e-11 LTPG1 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) AT4G14815 59 / 6e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G195700 [exp] 157 / 5e-49 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G008500 [exp] 153 / 3e-47 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G217000 [exp] 153 / 4e-47 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G172400 [exp] 72 / 8e-16 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.015G053700 [exp] 67 / 8e-14 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 67 / 8e-14 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G056200 [exp] 63 / 3e-12 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.008G155100 [exp] 60 / 3e-11 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 59 / 4e-11 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035975 [exp] 159 / 3e-46 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10042449 [exp] 140 / 8e-42 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026220 [exp] 125 / 1e-34 AT2G44300 131 / 6e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017749 [exp] 114 / 6e-32 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033076 [exp] 106 / 1e-28 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10015779 [exp] 78 / 4e-18 AT1G27950 144 / 8e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10037027 [exp] 77 / 2e-17 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10006413 [exp] 67 / 6e-14 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10032488 [exp] 61 / 1e-11 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042984 [exp] 61 / 2e-11 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.001G232000.1 pacid=42793577 polypeptide=Potri.001G232000.1.p locus=Potri.001G232000 ID=Potri.001G232000.1.v4.1 annot-version=v4.1 ATGGATTCCCATTCCCATTACACTACAATTCGACTAACAATGTTCGGCATAGTGTTGATGTCAGTTATGGTTAGCTTAGCAATGGCAGGTAAGGACAAAG ATAGTGAAGAATGTGCAGAGCAGCTGGTAGGACTGGCTACATGTCTGCCTTATGTTGGAGGAGATGCCAAAGCTCCTACCCCAGATTGCTGCAATGGTCT AAAGCAGGTCCTGAAGGACAACAAAAAGTGCTTGTGTGTCATTATTAAAGACAGGAATGATCCTGAATTGGGTCTCAAGATCAACGCCACTCTTGCTTTG AGCCTCCCTTCTGTTTGCCATGCCCCTGCCAACGTTTCCCAGTGTCCCGCTCTTCTCAACCTGCCTCCAAACTCACCAGATGCTCAGATTTTCTATCAAT TAGCAAACAGCTCTAATCATATTGCCAGCAGCCCCGCTCTCAGCCCCAGCCCTGGAGGTGCCCAACCCCAGGGAAGAAGTGCTCAACAAGAGAGTAATGG ATGCCACAGTGGGAAGATAAACTTTGGCTTGCAGATTGCTTCTTTAGGGGTTTTAGGGTGGTGTTTCAATATCTATTCACACTTGTTCATGTAG
AA sequence Show only first row Show all	>Potri.001G232000.1 pacid=42793577 polypeptide=Potri.001G232000.1.p locus=Potri.001G232000 ID=Potri.001G232000.1.v4.1 annot-version=v4.1 MDSHSHYTTIRLTMFGIVLMSVMVSLAMAGKDKDSEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLKQVLKDNKKCLCVIIKDRNDPELGLKINATLAL SLPSVCHAPANVSQCPALLNLPPNSPDAQIFYQLANSSNHIASSPALSPSPGGAQPQGRSAQQESNGCHSGKINFGLQIASLGVLGWCFNIYSHLFM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44300			Bifunctional inhibitor/lipid-t...		Potri.001G232000 [exp]	0	1
AT2G37870			Bifunctional inhibitor/lipid-t...		Potri.008G141000 [exp]	1.41	0.8722
AT3G63250		HMT-2, ATHMT-2 ...	HOMOCYSTEINE METHYLTRANSFERASE...		Potri.002G049800 [exp]	3.74	0.7285	HMT1,SMTA.1
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Potri.002G079500 [exp]	5.74	0.7619	PTRAAP8,AAP3.1
AT5G20480		EFR	EF-TU receptor (.1)		Potri.005G031700 [exp]	7.74	0.6994
AT3G51895		AST12, ATST1, S...	sulfate transporter 3;1 (.1)		Potri.008G156600 [exp]	9.38	0.7219
AT1G01900		SBTI1.1, ATSBT1...	subtilase family protein (.1)		Potri.014G074600 [exp]	10.77	0.6664
AT5G53140			Protein phosphatase 2C family ...		Potri.015G019200 [exp]	11.13	0.6611
AT5G41380			CCT motif family protein (.1)		Potri.003G130500 [exp]	12.72	0.7290
AT5G62350			Plant invertase/pectin methyle...		Potri.015G128700 [exp]	13.78	0.7373
					Potri.005G089750 [exp]	17.32	0.6712

Compare expression of checked genes

Potri.001G232000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.