Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RAB8.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59840 333 / 1e-117 Ras-related small GTP-binding family protein (.1) AT3G46060 332 / 7e-117 ARA3, Ara-3, AtRABE1c, AtRab8A RAB GTPase homolog 8A (.1.2.3) AT3G53610 326 / 9e-115 ATRAB8, AtRab8B, AtRABE1a RAB GTPase homolog 8 (.1.2.3) AT5G03520 314 / 7e-110 ATRAB-E1D, AtRab8C, AtRABE1d ARABIDOPSIS RAB HOMOLOG E1D, RAB GTPase homolog 8C (.1.2) AT3G09900 311 / 6e-109 AtRABE1e, AtRab8E RAB GTPase homolog E1E (.1) AT1G02130 215 / 3e-71 ARA5, AtRABD2a, AtRab1B, Ara-5 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) AT5G47200 201 / 2e-65 AtRABD2b, AtRab1A ARABIDOPSIS RAB GTPASE HOMOLOG D2B, RAB GTPase homolog 1A (.1) AT4G17530 200 / 4e-65 RAB1C, AtRab1C, AtRABD2c RAB GTPase homolog 1C (.1) AT3G11730 197 / 4e-64 ATFP8, AtRABD1 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1) AT4G17160 164 / 3e-51 AtRab2B, AtRABB1a RAB GTPase homolog B1A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G051700 [exp] 329 / 5e-116 AT3G46060 329 / 7e-116 RAB GTPase homolog 8A (.1.2.3) Potri.010G208900 [exp] 327 / 5e-115 AT3G46060 349 / 5e-124 RAB GTPase homolog 8A (.1.2.3) Potri.009G027900 [exp] 325 / 3e-114 AT3G46060 341 / 8e-121 RAB GTPase homolog 8A (.1.2.3) Potri.014G049400 [exp] 209 / 1e-68 AT1G02130 390 / 2e-140 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.001G080400 [exp] 209 / 1e-68 AT1G02130 387 / 2e-139 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.003G081800 [exp] 208 / 3e-68 AT1G02130 391 / 9e-141 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.002G138400 [exp] 207 / 4e-68 AT1G02130 393 / 1e-141 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.001G152800 [exp] 206 / 2e-67 AT1G02130 382 / 2e-137 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.004G226600 [exp] 199 / 5e-65 AT3G11730 364 / 4e-130 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005890 [exp] 328 / 2e-115 AT3G46060 396 / 2e-142 RAB GTPase homolog 8A (.1.2.3) Lus10005443 [exp] 320 / 2e-112 AT3G46060 394 / 2e-141 RAB GTPase homolog 8A (.1.2.3) Lus10007698 [exp] 315 / 1e-110 AT3G46060 378 / 1e-135 RAB GTPase homolog 8A (.1.2.3) Lus10024423 [exp] 312 / 1e-109 AT3G46060 376 / 7e-135 RAB GTPase homolog 8A (.1.2.3) Lus10025309 [exp] 309 / 4e-108 AT3G46060 374 / 1e-133 RAB GTPase homolog 8A (.1.2.3) Lus10040856 [exp] 307 / 2e-107 AT3G46060 366 / 7e-131 RAB GTPase homolog 8A (.1.2.3) Lus10023430 [exp] 301 / 3e-104 AT3G46060 364 / 3e-129 RAB GTPase homolog 8A (.1.2.3) Lus10004944 [exp] 296 / 4e-103 AT3G46060 348 / 1e-123 RAB GTPase homolog 8A (.1.2.3) Lus10003984 [exp] 245 / 2e-83 AT3G46060 289 / 5e-101 RAB GTPase homolog 8A (.1.2.3) Lus10000595 [exp] 208 / 3e-68 AT5G47200 387 / 3e-139 ARABIDOPSIS RAB GTPASE HOMOLOG D2B, RAB GTPase homolog 1A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.001G236100.1 pacid=42792639 polypeptide=Potri.001G236100.1.p locus=Potri.001G236100 ID=Potri.001G236100.1.v4.1 annot-version=v4.1 ATGGCTGCTCCTCCCGCTAGAGCTCGAGCCGATTATGATTATCTCATTAAGCTTCTCTTGATTGGCGATAGCGGTGTGGGCAAGAGTTGCCTTCTTTTGC GTTTCTCTGATGGTTCCTTCACTACTAGTTTTATCACCACCATTGGTATTGACTTTAAGATAAGAACCATTGAGCTTGATGGCAAAAGGATTAAGCTTCA AATTTGGGATACAGCTGGTCAGGAGCGGTTTCGAACAATCACAACTGCTTACTATCGCGGAGCTATGGGTATTTTGCTGGTGTATGATGTCACCGATGAA TCATCTTTCAACAACATTAGGAATTGGATTCGCAACATCGAGCAACATGCTTCTGATAATGTTAACAAGATATTGGTAGGGAACAAGGCTGACATGGATG AAAGCAAACGGGCTGTGCCAACATCCAAGGGCCAAGCACTTGCTGATGAATATGGGATCAAATTCTTTGAAACTAGTGCAAAGACAAATCTAAACGTGGA GCAAGTTTTCTTTTCAATAGCAAGGGATATAAAGCAAAGGCTTGCTGACACCGACACAAGGGCTGAGCCTACTACGTTGAAGATCACTCCAACAGACCAG GCAGGCGGAGGTGGTCAAGCTGCCCAGAAATCTTCTTGCTGTGGTTCTTAA
AA sequence Show only first row Show all	>Potri.001G236100.1 pacid=42792639 polypeptide=Potri.001G236100.1.p locus=Potri.001G236100 ID=Potri.001G236100.1.v4.1 annot-version=v4.1 MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDE SSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEQVFFSIARDIKQRLADTDTRAEPTTLKITPTDQ AGGGGQAAQKSSCCGS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59840			Ras-related small GTP-binding ...		Potri.001G236100 [exp]	0	1	Pt-RAB8.2
AT3G44610			Protein kinase superfamily pro...		Potri.010G236200 [exp]	3.60	0.9397
AT1G80690			PPPDE putative thiol peptidase...		Potri.001G047800 [exp]	6.32	0.9293
AT5G66920		SKS17	SKU5 similar 17 (.1)		Potri.007G038300 [exp]	6.63	0.9338
AT5G06940			Leucine-rich repeat receptor-l...		Potri.016G051600 [exp]	7.34	0.9254
AT1G04040			HAD superfamily, subfamily III...		Potri.002G257700 [exp]	7.74	0.9329
AT3G63470		SCPL40	serine carboxypeptidase-like 4...		Potri.009G055900 [exp]	8.00	0.9226
AT4G39730			Lipase/lipooxygenase, PLAT/LH2...		Potri.003G107100 [exp]	9.94	0.9219
AT3G44610			Protein kinase superfamily pro...		Potri.008G024000 [exp]	10.58	0.9248
AT1G32860			Glycosyl hydrolase superfamily...		Potri.001G449100 [exp]	10.58	0.9164
AT5G06940			Leucine-rich repeat receptor-l...		Potri.006G056600 [exp]	11.83	0.9212

Compare expression of checked genes

Potri.001G236100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.