Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46020 93 / 2e-25 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G59860 69 / 3e-15 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G37510 45 / 1e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 45 / 2e-06 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT3G14100 45 / 4e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G47320 45 / 5e-06 RPS19 ribosomal protein S19 (.1) AT1G49760 44 / 1e-05 PABP8, PAB8 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2) AT1G54080 44 / 1e-05 UBP1A oligouridylate-binding protein 1A (.1.2) AT1G17370 42 / 4e-05 UBP1B oligouridylate binding protein 1B (.1.2) AT5G06000 41 / 0.0001 ATEIF3G2, EIF3G2 ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITIATION FACTOR 3G2, eukaryotic translation initiation factor 3G2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G208500 [exp] 53 / 2e-09 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.017G059000 [exp] 48 / 9e-08 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.009G160300 [exp] 43 / 7e-06 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G319900 [exp] 43 / 7e-06 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.015G057400 [exp] 43 / 2e-05 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.002G062700 [exp] 43 / 3e-05 AT1G22760 638 / 0.0 poly(A) binding protein 3 (.1) Potri.003G069000 [exp] 42 / 6e-05 AT1G17370 621 / 0.0 oligouridylate binding protein 1B (.1.2) Potri.001G166100 [exp] 42 / 6e-05 AT1G17370 622 / 0.0 oligouridylate binding protein 1B (.1.2) Potri.006G139300 [exp] 42 / 8e-05 AT1G17370 580 / 0.0 oligouridylate binding protein 1B (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040854 [exp] 82 / 3e-21 AT3G46020 112 / 1e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10005891 [exp] 73 / 4e-16 AT3G45980 230 / 1e-76 HISTONE H2B, Histone superfamily protein (.1) Lus10023758 [exp] 50 / 3e-08 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003980 [exp] 49 / 9e-08 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10013306 [exp] 45 / 2e-06 AT5G06210 94 / 3e-25 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10011924 [exp] 44 / 2e-05 AT1G17370 578 / 0.0 oligouridylate binding protein 1B (.1.2) Lus10027641 [exp] 44 / 2e-05 AT1G17370 569 / 0.0 oligouridylate binding protein 1B (.1.2) Lus10040519 [exp] 43 / 4e-05 AT5G61030 189 / 2e-53 glycine-rich RNA-binding protein 3 (.1) Lus10021154 [exp] 42 / 5e-05 AT5G61030 188 / 5e-58 glycine-rich RNA-binding protein 3 (.1) Lus10008130 [exp] 42 / 7e-05 AT1G17370 664 / 0.0 oligouridylate binding protein 1B (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.001G236200.1 pacid=42793165 polypeptide=Potri.001G236200.1.p locus=Potri.001G236200 ID=Potri.001G236200.1.v4.1 annot-version=v4.1 ATGGCACAAAGAATAGGCTTACAGCTCTTTGTCAGCAGATTATCATCATACACGACAAATCATGAGCTCAAAAGGTTGTTTTCTCCCTTCGGTGCTGTTT CGGAAGGTAAAAGAAGATTTCACTTGCTTTCAATTACCTTTCATTCTTTATCTGTTTTGTTTTTAAACAAATATTTTCTAATTTATGTTGTCTGTGTAGC TAGACTAGTTGTTGAATCAAAAACACTCAGGCCGAAAGGGTTTGGTTTTGTTACTTTCGAGTCAGAGGCTGATGCACACAAGGCATTGAAGGCAATGAAT GGCAGGGTATTTTCCTACTTTCTTCTCTGTTTTTTTCTTAATGTTTTCCTAATGGCCACTAAATTATCTTGCCGAACATTTTCCCTCTTTCTCGTGTTTG TAAATTCAGTTATCCTTCACGGATTTCTTGCTCAAACTTTGTAG
AA sequence Show only first row Show all	>Potri.001G236200.1 pacid=42793165 polypeptide=Potri.001G236200.1.p locus=Potri.001G236200 ID=Potri.001G236200.1.v4.1 annot-version=v4.1 MAQRIGLQLFVSRLSSYTTNHELKRLFSPFGAVSEGKRRFHLLSITFHSLSVLFLNKYFLIYVVCVARLVVESKTLRPKGFGFVTFESEADAHKALKAMN GRVFSYFLLCFFLNVFLMATKLSCRTFSLFLVFVNSVILHGFLAQTL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G46020			RNA-binding (RRM/RBD/RNP motif...		Potri.001G236200 [exp]	0	1
AT2G19560		ESSP1, AtTHP1, ...	ectopic expression of seed sto...		Potri.006G221700 [exp]	1.73	0.8409
AT1G30825		DIS2, ARPC2, AR...	DISTORTED TRICHOMES 2, ACTIN-R...		Potri.003G157700 [exp]	3.31	0.8656	Pt-ARPC2.1
AT1G29850			double-stranded DNA-binding fa...		Potri.001G352600 [exp]	7.48	0.7936
AT1G04190		TPR3	tetratricopeptide repeat 3, Te...		Potri.010G082900 [exp]	8.36	0.8026
AT5G65880			unknown protein		Potri.007G006700 [exp]	12.48	0.8251
					Potri.010G007250 [exp]	14.00	0.8320
AT5G39410			Saccharopine dehydrogenase (....		Potri.004G126100 [exp]	14.69	0.8410
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Potri.006G110100 [exp]	19.39	0.8397
AT4G36760		ATAPP1	ARABIDOPSIS THALIANA AMINOPEPT...		Potri.007G029700 [exp]	22.64	0.8062	APP1.2
AT5G01160			RING/U-box superfamily protein...		Potri.006G095600 [exp]	22.97	0.8321

Compare expression of checked genes

Potri.001G236200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.