Potri.001G236300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13850 88 / 2e-23 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
AT3G23830 86 / 6e-23 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2)
AT5G47320 79 / 4e-19 RPS19 ribosomal protein S19 (.1)
AT5G61030 80 / 5e-19 GR-RBP3 glycine-rich RNA-binding protein 3 (.1)
AT1G74230 79 / 5e-19 GR-RBP5 glycine-rich RNA-binding protein 5 (.1)
AT5G06210 73 / 1e-17 RNA binding (RRM/RBD/RNP motifs) family protein (.1)
AT2G21660 69 / 4e-16 CCR2, ATGRP7, GR-RBP7 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2)
AT1G18630 69 / 4e-16 GR-RBP6 glycine-rich RNA-binding protein 6 (.1)
AT3G08000 69 / 6e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
AT4G39260 67 / 6e-16 ATGRP8, CCR1, GR-RBP8 glycine-rich RNA-binding protein 8, GLYCINE-RICH PROTEIN 8, cold, circadian rhythm, and RNA binding 1 (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G059000 85 / 1e-22 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Potri.012G061600 83 / 2e-20 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1)
Potri.015G057400 82 / 2e-20 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1)
Potri.001G319900 80 / 2e-20 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Potri.006G208500 77 / 3e-19 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1)
Potri.009G116400 76 / 2e-18 AT2G21660 145 / 5e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2)
Potri.001G319800 74 / 5e-18 AT4G13850 137 / 2e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Potri.004G155300 74 / 6e-18 AT2G21660 145 / 3e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2)
Potri.008G022280 72 / 4e-17 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022551 90 / 4e-24 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10016639 89 / 1e-23 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10017852 91 / 2e-23 AT5G61030 178 / 7e-55 glycine-rich RNA-binding protein 3 (.1)
Lus10034685 90 / 4e-23 AT5G61030 177 / 7e-54 glycine-rich RNA-binding protein 3 (.1)
Lus10043158 87 / 8e-23 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10032591 86 / 1e-22 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10021154 86 / 2e-21 AT5G61030 188 / 5e-58 glycine-rich RNA-binding protein 3 (.1)
Lus10040519 83 / 8e-20 AT5G61030 189 / 2e-53 glycine-rich RNA-binding protein 3 (.1)
Lus10023569 75 / 3e-18 AT2G21660 147 / 8e-46 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2)
Lus10025573 74 / 1e-16 AT3G20930 336 / 3e-109 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0221 RRM PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence
>Potri.001G236300.1 pacid=42793365 polypeptide=Potri.001G236300.1.p locus=Potri.001G236300 ID=Potri.001G236300.1.v4.1 annot-version=v4.1
ATGCAGTGTCTGAATCGAAGTGTCAGTCTGCCCTTAGCCAGACGGTTATTGGCCCGCCACTTATCCACCAAATTATTTGTTGGAGGGCTTTCTTATGACA
CCAATGAAACTGTTTTAAAGGATGCTTTTGGAAAATATGGTGAAATAATTGAAGCAGTGAAAGTGATATGTCACCGAGTGTATGGTGAATCCAAAGGCTA
CGGCTTTGTGCAGTTCTCTTCTGAAGCTGCAGCCAGCACAGCTTTGAAAGAAATGGATGGCCAGTTGCTGGATGACCGAAATATCCGTGTGCATTATGCT
CATAAGTGGTCATGA
AA sequence
>Potri.001G236300.1 pacid=42793365 polypeptide=Potri.001G236300.1.p locus=Potri.001G236300 ID=Potri.001G236300.1.v4.1 annot-version=v4.1
MQCLNRSVSLPLARRLLARHLSTKLFVGGLSYDTNETVLKDAFGKYGEIIEAVKVICHRVYGESKGYGFVQFSSEAAASTALKEMDGQLLDDRNIRVHYA
HKWS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G13850 ATGRP2, GR-RBP2 glycine rich protein 2, glycin... Potri.001G236300 0 1
AT3G54540 ABCF4, ATGCN4 ATP-binding cassette F4, gener... Potri.016G015550 15.96 0.6824
AT5G41010 NRPE12, NRPD12,... DNA directed RNA polymerase, 7... Potri.011G144800 17.14 0.7024
AT5G27660 Trypsin family protein with PD... Potri.013G018300 20.32 0.6495
AT2G06010 ORG4 OBP3-responsive gene 4 (.1) Potri.018G065800 30.29 0.6274 ORG4.2
Potri.015G068850 47.77 0.6295
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.003G014750 47.90 0.6282
AT3G56690 CIP111 Cam interacting protein 111 (.... Potri.016G032666 63.49 0.6116
AT5G12240 unknown protein Potri.001G274400 70.00 0.5752
Potri.019G089100 71.62 0.6108
AT3G04680 CLPS3 CLP-similar protein 3 (.1.2) Potri.017G077200 72.12 0.5851

Potri.001G236300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.