ADF.3,ADF2 (Potri.001G236400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol ADF.3,ADF2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59890 246 / 1e-85 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2)
AT3G46000 246 / 1e-85 ADF2 actin depolymerizing factor 2 (.1)
AT3G46010 246 / 2e-85 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2)
AT5G59880 239 / 5e-83 ADF3 actin depolymerizing factor 3 (.1.2)
AT1G01750 233 / 1e-80 ADF11 actin depolymerizing factor 11 (.1)
AT4G00680 231 / 1e-79 ADF8 actin depolymerizing factor 8 (.1)
AT5G52360 227 / 4e-78 ADF10 actin depolymerizing factor 10 (.1)
AT4G25590 226 / 1e-77 ADF7 actin depolymerizing factor 7 (.1)
AT2G31200 186 / 9e-62 ADF6, ATADF6 actin depolymerizing factor 6 (.1)
AT2G16700 174 / 8e-57 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G236700 273 / 2e-96 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2)
Potri.009G028200 273 / 3e-96 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2)
Potri.009G028100 270 / 7e-95 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Potri.008G052100 258 / 3e-90 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2)
Potri.010G208500 257 / 6e-90 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2)
Potri.001G106200 239 / 8e-83 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1)
Potri.003G125500 235 / 2e-81 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1)
Potri.015G144500 231 / 1e-79 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1)
Potri.012G141600 230 / 3e-79 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024418 255 / 4e-89 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2)
Lus10024417 252 / 6e-88 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10025319 252 / 6e-88 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10023428 252 / 7e-85 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2)
Lus10040307 249 / 2e-84 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2)
Lus10027474 226 / 1e-77 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1)
Lus10038859 219 / 8e-75 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1)
Lus10014977 218 / 2e-74 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1)
Lus10039229 213 / 2e-72 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1)
Lus10008489 197 / 7e-66 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0092 ADF PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence
>Potri.001G236400.2 pacid=42791693 polypeptide=Potri.001G236400.2.p locus=Potri.001G236400 ID=Potri.001G236400.2.v4.1 annot-version=v4.1
ATGGCCAACGCAGCATCTGGTATGGCTGTGCATGATGACTGCAAGCTGAAGTTCTTGGAGCTGAAGGCTAAAAGAACTTACCGATCCATAGTTTTTAAGA
TTGAAGAAAAGCTAAAGCAGGTTATTGTGGAGAAGCTGGGTGAGCCAGCTCAAAGCTATGAAGATTTTACTGCAAGCATCCCTGCTGATGAGTGTCGATA
TGCTGTTTATGATTTTGATTTCATGACTGCAGAGAATGTTCAAAAGAGCAGGATTTTCTTCATTGCATGGTCCCCTGACACATCAAGGGTGAGAAGCAAG
ATGATTTATGCCAGCTCTAAGGACAGGTTTAAGAGAGAATTGGATGGTATTCAGATAGAGTTGCAGGCAACTGATCCAACTGAAATGGGTCTTGATGTCA
TTAGAAGCCGTGCCAGTTAA
AA sequence
>Potri.001G236400.2 pacid=42791693 polypeptide=Potri.001G236400.2.p locus=Potri.001G236400 ID=Potri.001G236400.2.v4.1 annot-version=v4.1
MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASIPADECRYAVYDFDFMTAENVQKSRIFFIAWSPDTSRVRSK
MIYASSKDRFKRELDGIQIELQATDPTEMGLDVIRSRAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Potri.001G236400 0 1 ADF.3,ADF2
AT3G43810 CAM7 calmodulin 7 (.1) Potri.009G021500 3.87 0.9291 Pt-ACCAL.1
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Potri.002G191400 4.69 0.9329 ARF1.2
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Potri.014G116500 6.63 0.9350 Pt-ARF1.1
AT2G44620 MTACP1, MTACP-1 mitochondrial acyl carrier pro... Potri.014G044000 8.36 0.9222
AT4G29340 PRF4 profilin 4 (.1) Potri.006G235200 10.39 0.9262 Pt-PRO1.4
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Potri.016G088200 11.40 0.9248 SYP71.2
AT3G55770 LIM WLIM2b WLIM2b, GATA type zinc finger ... Potri.010G193800 12.24 0.9108
AT3G60550 CYCP3;2 cyclin p3;2 (.1) Potri.014G066400 15.71 0.9057
AT1G72210 bHLH bHLH096 basic helix-loop-helix (bHLH) ... Potri.013G025900 18.11 0.8851
AT2G25610 ATPase, F0/V0 complex, subunit... Potri.018G032600 18.76 0.8888

Potri.001G236400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.