Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59950 187 / 1e-59 RNA-binding (RRM/RBD/RNP motifs) family protein AT5G02530 159 / 9e-48 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT1G66260 122 / 3e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G37720 120 / 5e-33 DIP2, ALY4 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2) AT2G23350 57 / 2e-09 PABP4, PAB4 poly(A) binding protein 4 (.1) AT2G37220 54 / 2e-08 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G34110 53 / 5e-08 PABP2, PAB2, ATPAB2 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1) AT1G71770 53 / 6e-08 PAB5 poly(A)-binding protein 5 (.1), poly(A)-binding protein 5 (.2) AT3G10400 52 / 1e-07 U11/U12-31K U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT2G36660 51 / 2e-07 PAB7 poly(A) binding protein 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G093944 [exp] 191 / 1e-60 AT5G59950 196 / 1e-62 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.010G208000 [exp] 142 / 2e-41 AT5G59950 138 / 8e-40 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.004G087000 [exp] 140 / 2e-40 AT5G37720 213 / 2e-68 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2) Potri.017G129900 [exp] 139 / 4e-40 AT1G66260 216 / 3e-69 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.008G052601 [exp] 100 / 2e-26 AT5G02530 97 / 2e-24 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.010G227500 [exp] 56 / 3e-09 AT3G10400 223 / 7e-73 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Potri.001G141300 [exp] 55 / 1e-08 AT2G35410 248 / 2e-81 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.005G198500 [exp] 55 / 2e-08 AT1G22760 623 / 0.0 poly(A) binding protein 3 (.1) Potri.014G157300 [exp] 51 / 3e-08 AT3G08000 129 / 2e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005895 [exp] 185 / 2e-58 AT5G02530 185 / 8e-58 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10024413 [exp] 177 / 3e-55 AT5G59950 219 / 1e-71 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10025329 [exp] 174 / 5e-54 AT5G59950 224 / 2e-73 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10004946 [exp] 174 / 8e-54 AT5G59950 209 / 3e-67 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10005445 [exp] 169 / 1e-51 AT5G59950 210 / 9e-68 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10000446 [exp] 143 / 3e-41 AT5G37720 211 / 1e-66 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2) Lus10010982 [exp] 137 / 1e-38 AT5G37720 209 / 7e-66 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2) Lus10023417 [exp] 119 / 1e-32 AT5G59950 130 / 3e-37 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10040851 [exp] 110 / 2e-28 AT5G02530 199 / 2e-64 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10040299 [exp] 62 / 4e-11 AT5G59950 77 / 1e-16 RNA-binding (RRM/RBD/RNP motifs) family protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) CL0221 [poplar] [flax] PF13865 [poplar] [flax] FoP_duplication C-terminal duplication domain of Friend of PRMT1
Representative CDS sequence Show only first row Show all	>Potri.001G236900.1 pacid=42789121 polypeptide=Potri.001G236900.1.p locus=Potri.001G236900 ID=Potri.001G236900.1.v4.1 annot-version=v4.1 ATGTCAAGCGCTTTGGATATGTCCCTCGACGATATCATCAAAAATAGCAAAAAACCCGGATCCGCTAACTTCCGGGGCCGTGGTCGAGGCCACCCTTCCG GAGCCGGTCCTGCTCGCCGCTTCCCTAACCGCGCCGCCAATCGTTCAGCTCCTTATACCGCCGCTAAGGCTCCGGAAAGCACGTGGCAACACGACATGTT CAGGGATCAATCAGGTCGGACCTCCTCTTTAGAAGGAGCAAAGCTCTATGTTTCCAATTTAGATTATGGAGTCTCTAACGAGGACATCAAGGAATTGTTC TTGGAAGTGGGTGAACTGAAAAGGTATTCGATCCATTACGATCGGAGTGGCAGATCGAAGGGAACGGCAGAAGTTGTCTTCGCACGACAAGCTGAAGCTG TCGCTGCTGTTAAGAGATACAACAATGTTCAGCTTGATGGGAAACCGATGAAGATAGAGATTGTGGGAACAAATTTTGTTGCTCCTCCTGCGCCTCCGGC TGCTAATGCTGCTTTTGGAAATTCTAATGGAGTTTCTGGACGTGGACGAGGTAGGGGTGGTGCACTGGGAAGACTGCGCGGCGTCGGCGTCGGCGGCGGA GGTGGACGTGGATTTGGAAGGGGACGCGGACGTGGAAGGGGCCGTGGTGAAAAGGTATCTGCTGAAGATCTTGATGCAGATTTGGAGAAGTATCATTCAG AAGCTATGCAGATAAATTAA
AA sequence Show only first row Show all	>Potri.001G236900.1 pacid=42789121 polypeptide=Potri.001G236900.1.p locus=Potri.001G236900 ID=Potri.001G236900.1.v4.1 annot-version=v4.1 MSSALDMSLDDIIKNSKKPGSANFRGRGRGHPSGAGPARRFPNRAANRSAPYTAAKAPESTWQHDMFRDQSGRTSSLEGAKLYVSNLDYGVSNEDIKELF LEVGELKRYSIHYDRSGRSKGTAEVVFARQAEAVAAVKRYNNVQLDGKPMKIEIVGTNFVAPPAPPAANAAFGNSNGVSGRGRGRGGALGRLRGVGVGGG GGRGFGRGRGRGRGRGEKVSAEDLDADLEKYHSEAMQIN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59950			RNA-binding (RRM/RBD/RNP motif...		Potri.001G236900 [exp]	0	1
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Potri.008G060000 [exp]	2.44	0.8324	Pt-EIF3.1
AT2G36300			Integral membrane Yip1 family ...		Potri.009G152600 [exp]	3.60	0.7676
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Potri.015G135300 [exp]	3.87	0.8341
AT3G54130			Josephin family protein (.1)		Potri.016G110300 [exp]	6.00	0.7722
AT5G18200			UTP:galactose-1-phosphate urid...		Potri.019G034400 [exp]	6.00	0.8125
AT3G06610			DNA-binding enhancer protein-r...		Potri.008G105000 [exp]	7.34	0.8152
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Potri.011G109500 [exp]	8.48	0.7308
AT5G40190			RNA ligase/cyclic nucleotide p...		Potri.001G350300 [exp]	10.24	0.8084
AT3G13920		RH4, TIF4A1, EI...	eukaryotic translation initiat...		Potri.018G061050 [exp]	12.96	0.7860
AT5G27990			Pre-rRNA-processing protein TS...		Potri.013G035000 [exp]	14.07	0.7962

Compare expression of checked genes

Potri.001G236900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.