Potri.001G240670 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G184800 54 / 6e-10 AT1G13790 526 / 1e-178 factor of DNA methylation 4, XH/XS domain-containing protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G240670.1 pacid=42791392 polypeptide=Potri.001G240670.1.p locus=Potri.001G240670 ID=Potri.001G240670.1.v4.1 annot-version=v4.1
ATGGGAGAAGATGAAGACCTGGATATTAGGGCAAAAATGGATACAGTTCGACAGGAACTGAAGGAGAAGGAAGAAGAATTAAGGGGATTGGAGGAACTTA
ATCAGGCTCTTATTTTCCAAGAGCGCAAAATAAATGATGAATTGCAGGAAGCTCTAAAGGAGTTAATTAATGAAATAATCAACGAGGATGATGAAAACTT
GAGAATTCTGAAGAGAGCTCTGGAATTTCAAGGAGAAAAGGAAGGCAACACTGAGTGA
AA sequence
>Potri.001G240670.1 pacid=42791392 polypeptide=Potri.001G240670.1.p locus=Potri.001G240670 ID=Potri.001G240670.1.v4.1 annot-version=v4.1
MGEDEDLDIRAKMDTVRQELKEKEEELRGLEELNQALIFQERKINDELQEALKELINEIINEDDENLRILKRALEFQGEKEGNTE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G240670 0 1
AT3G52600 ATCWINV2 cell wall invertase 2 (.1.2) Potri.016G077500 9.05 0.7690 Pt-VI1.1
AT5G23570 SGS3, ATSGS3 SUPPRESSOR OF GENE SILENCING 3... Potri.003G188200 24.97 0.6749
AT5G53980 HD ATHB52 homeobox protein 52 (.1) Potri.017G016900 36.46 0.6811
AT3G52660 RNA-binding (RRM/RBD/RNP motif... Potri.004G201900 53.28 0.6872
AT3G11590 unknown protein Potri.009G160900 69.96 0.6440
AT1G53050 Protein kinase superfamily pro... Potri.005G086900 75.04 0.6075
AT2G45520 unknown protein Potri.014G072400 75.49 0.6296
AT1G15110 PSS1 phosphatidylserine synthase 1,... Potri.008G126100 87.08 0.6277
AT4G21430 B160 Zinc finger, RING-type;Transcr... Potri.004G032700 91.72 0.6500
Potri.005G161366 100.81 0.6042

Potri.001G240670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.