Potri.001G241500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59410 189 / 4e-63 Rab5-interacting family protein (.1)
AT2G29020 154 / 2e-49 Rab5-interacting family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G032100 205 / 1e-69 AT5G59410 155 / 7e-50 Rab5-interacting family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040798 182 / 2e-60 AT5G59410 202 / 2e-68 Rab5-interacting family protein (.1)
Lus10016530 139 / 1e-43 AT5G59410 154 / 1e-49 Rab5-interacting family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07019 Rab5ip Rab5-interacting protein (Rab5ip)
Representative CDS sequence
>Potri.001G241500.1 pacid=42789251 polypeptide=Potri.001G241500.1.p locus=Potri.001G241500 ID=Potri.001G241500.1.v4.1 annot-version=v4.1
ATGAAGGAAGGGAAATCCTCTGCTAAATTGAACAACAACAACAATCAACAGCAGCAGCACCAAAATGGTCACTTGTCTCCTTTCAAACTCGCCAAATTGT
TGGATCCTGAAGCCTCTTGGGATAAGGATCAATTGGGAGATGTGTTGCATTGGATTAGGCAAGTCGTCGCCCTCGTTTGCGGATTACTATGGGGTGCCAT
CCCTTTGGTCGGCGGTATTTGGATCGCCCTTTTTCTGTTGATATCCTCTGGGATTATATATGTTTATTATGGGATGATATTAAAGATCGACGAGGATGAT
TTTGGTGGTCATGGAACTCTACTCCAAGAGGGGCTCTTTGCTTCTATCACTCTATTTCTGCTATCGTGGATTCTAATGTACAGCTTGGCCCACTTCTGA
AA sequence
>Potri.001G241500.1 pacid=42789251 polypeptide=Potri.001G241500.1.p locus=Potri.001G241500 ID=Potri.001G241500.1.v4.1 annot-version=v4.1
MKEGKSSAKLNNNNNQQQQHQNGHLSPFKLAKLLDPEASWDKDQLGDVLHWIRQVVALVCGLLWGAIPLVGGIWIALFLLISSGIIYVYYGMILKIDEDD
FGGHGTLLQEGLFASITLFLLSWILMYSLAHF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G59410 Rab5-interacting family protei... Potri.001G241500 0 1
AT5G43330 c-NAD-MDH2 cytosolic-NAD-dependent malate... Potri.010G071000 1.41 0.9615
AT1G76400 Ribophorin I (.1) Potri.002G006600 1.41 0.9573
AT1G13730 Nuclear transport factor 2 (NT... Potri.010G157800 2.82 0.9453
AT2G16595 Translocon-associated protein ... Potri.004G168500 3.87 0.9562
AT5G63400 ADK1 adenylate kinase 1 (.1.2) Potri.012G095300 4.47 0.9408
AT1G09580 emp24/gp25L/p24 family/GOLD fa... Potri.001G210900 5.00 0.9453
AT5G37510 CI76, EMB1467 embryo defective 1467, NADH-ub... Potri.017G136950 6.16 0.9351
AT1G65270 unknown protein Potri.019G055100 7.14 0.9370
AT1G50670 OTU-like cysteine protease fam... Potri.011G139500 8.30 0.9329
AT1G04430 S-adenosyl-L-methionine-depend... Potri.002G036732 9.16 0.9444

Potri.001G241500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.