Plant FIBer expression Database

Potri.001G242104 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59460 38 / 4e-05 scarecrow-like transcription factor 11 (SCL11) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G033400
[exp]
51 / 1e-09 AT5G59460 126 / 5e-37 scarecrow-like transcription factor 11 (SCL11) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001576
[exp]
36 / 0.0003 AT5G59460 111 / 2e-31 scarecrow-like transcription factor 11 (SCL11) (.1)
PFAM info
Representative CDS sequence
>Potri.001G242104.1 pacid=42793059 polypeptide=Potri.001G242104.1.p locus=Potri.001G242104 ID=Potri.001G242104.1.v4.1 annot-version=v4.1
ATGGCTAAGCAGGAGCTCTCCTGCACTTTGAAGAACTTGATGTTCATACAAAGAGCAGCTCAGAGAGATGAGAGAATTAGGAAACAAGAAGAAGAGGTCA
AACCTGGTGGGAATTTCTTTTTCCCTGGTATCATTAACAAGTGGTAA
AA sequence
>Potri.001G242104.1 pacid=42793059 polypeptide=Potri.001G242104.1.p locus=Potri.001G242104 ID=Potri.001G242104.1.v4.1 annot-version=v4.1
MAKQELSCTLKNLMFIQRAAQRDERIRKQEEEVKPGGNFFFPGIINKW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G59460 scarecrow-like transcription f... Potri.001G242104
[exp]
0 1
AT1G45249 bZIP AtABF2, ATAREB1... ABSCISIC ACID RESPONSIVE ELEME... Potri.001G371300
[exp]
7.74 0.8586
Potri.010G000301
[exp]
10.24 0.8586
AT1G33430 Galactosyltransferase family p... Potri.019G067300
[exp]
15.49 0.7741
AT5G40780 LHT1, LTH1 lysine histidine transporter 1... Potri.015G091600
[exp]
23.23 0.5897 PtrLHT1
AT3G30180 CYP85A2, BR6OX2 brassinosteroid-6-oxidase 2 (.... Potri.010G156800
[exp]
25.37 0.5875
AT3G01820 P-loop containing nucleoside t... Potri.012G095700
[exp]
45.16 0.6266
AT5G28780 PIF1 helicase (.1) Potri.003G004501
[exp]
46.95 0.5027
Potri.012G100750
[exp]
48.49 0.5027
AT5G38760 Late embryogenesis abundant pr... Potri.004G107100
[exp]
55.18 0.4290
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.012G114900
[exp]
63.79 0.4937

Potri.001G242104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.