Potri.001G243500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29180 64 / 6e-13 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G034951 42 / 1e-05 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040781 51 / 4e-08 AT2G29180 83 / 2e-20 unknown protein
Lus10016512 49 / 2e-07 AT2G29180 82 / 4e-20 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G243500.1 pacid=42789953 polypeptide=Potri.001G243500.1.p locus=Potri.001G243500 ID=Potri.001G243500.1.v4.1 annot-version=v4.1
ATGGCGATAACATCATATCCTATGATCTCACTACCTCCACCACATCTTCTCTCCGTTACCAAGACCAAACCCCCTCACTCTTGTATTCACAACCACAACA
AAGCTTTAACTCTCACCTCCCCTCTCTCCTTATCCAATCCTCTACCATCAAAAAGAACTGTTCTTTATAAACAAGAAATTCATCGCAGGAGCACCCAAAT
TTGGAAAATTAAAGCAACCCCTGAAGAGGTCTTGCCTTCAGATACAACCCCACTGGAGAGTACCCAGCAGATGTTGTCCACCACTAATGATGATGGAGTT
GGCACTATCATATCAGCCCTTCTTTTCGTTGCCTTTGCTGCTCTATCCATTCTCACTATTGGGATAATCTACTTAGGAGTAACAGATTTCTTGCAGAAGA
GGGAGACAGATAAGCTTCAGAAGGAAGAGGAATCTAAGAAGAAGAAGAGAGTGAAGAAAAGAAAGGTGAGAGCAAGGTCTGGGCCAAGAGGATTTGGGCA
GAAGATCAATGAAGATGATGAATTTGATGATTAG
AA sequence
>Potri.001G243500.1 pacid=42789953 polypeptide=Potri.001G243500.1.p locus=Potri.001G243500 ID=Potri.001G243500.1.v4.1 annot-version=v4.1
MAITSYPMISLPPPHLLSVTKTKPPHSCIHNHNKALTLTSPLSLSNPLPSKRTVLYKQEIHRRSTQIWKIKATPEEVLPSDTTPLESTQQMLSTTNDDGV
GTIISALLFVAFAALSILTIGIIYLGVTDFLQKRETDKLQKEEESKKKKRVKKRKVRARSGPRGFGQKINEDDEFDD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G29180 unknown protein Potri.001G243500 0 1
AT2G33450 Ribosomal L28 family (.1) Potri.010G068500 4.47 0.9746
AT5G07900 Mitochondrial transcription te... Potri.001G035200 6.48 0.9690
AT3G56010 unknown protein Potri.010G186800 9.48 0.9665
AT3G26070 Plastid-lipid associated prote... Potri.001G209600 10.95 0.9675
AT4G17040 HON5, CLPR4 happy on norflurazon 5, CLP pr... Potri.003G083300 13.56 0.9666
AT1G60230 Radical SAM superfamily protei... Potri.010G040700 15.00 0.9626
AT4G25040 Uncharacterised protein family... Potri.017G062100 16.30 0.9511
AT5G03940 SRP54CP, CPSRP5... SIGNAL RECOGNITION PARTICLE 54... Potri.006G211500 17.14 0.9638 Pt-FFC.2
AT3G53130 CYP97C1, LUT1 LUTEIN DEFICIENT 1, CYTOCHROME... Potri.006G119800 20.39 0.9596 CYP97C4
AT4G37040 MAP1D methionine aminopeptidase 1D (... Potri.005G137400 20.90 0.9577 MAP1.2

Potri.001G243500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.