Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29530 139 / 4e-45 TIM10 Tim10/DDP family zinc finger protein (.1.2.3) AT1G61570 36 / 0.0005 TIM13 translocase of the inner mitochondrial membrane 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G039600 [exp] 178 / 2e-60 AT2G29530 141 / 1e-45 Tim10/DDP family zinc finger protein (.1.2.3) Potri.012G039100 [exp] 38 / 0.0001 AT3G46560 154 / 1e-50 embryo defective 2474, Tim10/DDP family zinc finger protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016453 [exp] 155 / 3e-51 AT2G29530 145 / 2e-47 Tim10/DDP family zinc finger protein (.1.2.3) Lus10040718 [exp] 151 / 1e-49 AT2G29530 146 / 1e-47 Tim10/DDP family zinc finger protein (.1.2.3) Lus10017463 [exp] 41 / 6e-06 AT3G46560 156 / 2e-51 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10037964 [exp] 35 / 0.0009 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10038695 [exp] 35 / 0.0009 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [poplar] [flax] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Potri.001G246500.1 pacid=42789174 polypeptide=Potri.001G246500.1.p locus=Potri.001G246500 ID=Potri.001G246500.1.v4.1 annot-version=v4.1 ATGGCTGCCAACAACGTTGGTCTACCAGCTGGTGTCTCCAAAGAACAGGCCTATGGCATGGCTGCGACCGAGATGGAATACAGAGTCGAGTTGTTTAACA GGCTTCTTAATACATGTTTCAACAAGTGCATTGACAAAAGGCACAAGGATGCTGAGCTAAACATGGGTGAAAATAGTTGTGTTGACAGATGTGTTTCAAA ATACTGGGCGGTGAATGGTATCATTGGCCAGATGCTTAGTGCTGGTCAACGTCCAATGTGA
AA sequence Show only first row Show all	>Potri.001G246500.1 pacid=42789174 polypeptide=Potri.001G246500.1.p locus=Potri.001G246500 ID=Potri.001G246500.1.v4.1 annot-version=v4.1 MAANNVGLPAGVSKEQAYGMAATEMEYRVELFNRLLNTCFNKCIDKRHKDAELNMGENSCVDRCVSKYWAVNGIIGQMLSAGQRPM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Potri.001G246500 [exp]	0	1
AT5G40080			Mitochondrial ribosomal protei...		Potri.005G161600 [exp]	2.00	0.8342
AT3G60360		EDA14, UTP11	U3 SMALL NUCLEOLAR RNA-ASSOCIA...		Potri.016G024300 [exp]	3.00	0.8387
AT4G31460			Ribosomal L28 family (.1)		Potri.018G006900 [exp]	8.83	0.8479
AT3G07590			Small nuclear ribonucleoprotei...		Potri.002G054800 [exp]	12.00	0.7954
AT2G31725			Eukaryotic protein of unknown ...		Potri.013G127400 [exp]	16.18	0.8460
AT5G05520			Outer membrane OMP85 family pr...		Potri.008G071800 [exp]	17.66	0.7727
AT3G06610			DNA-binding enhancer protein-r...		Potri.010G146100 [exp]	22.24	0.8108
AT2G44860			Ribosomal protein L24e family ...		Potri.009G148500 [exp]	22.97	0.7917
AT1G18080		RACK1A_AT, ATAR...	RECEPTOR FOR ACTIVATED C KINAS...		Potri.015G041600 [exp]	31.30	0.8285	Pt-GBF1.2
AT4G12600			Ribosomal protein L7Ae/L30e/S1...		Potri.013G116800 [exp]	32.58	0.8225

Compare expression of checked genes

Potri.001G246500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.