Pt-ATRPC14.1 (Potri.001G246600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-ATRPC14.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29540 137 / 3e-43 ATRPAC14, ATRPC14 RNApolymerase 14 kDa subunit (.1.2.3)
AT3G52090 54 / 2e-10 NRPE11, NRPD11, NRPB11, ATRPB13.6 DNA-directed RNA polymerase, RBP11-like (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G070900 52 / 7e-10 AT3G52090 219 / 2e-75 DNA-directed RNA polymerase, RBP11-like (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040717 171 / 5e-57 AT2G29540 132 / 3e-41 RNApolymerase 14 kDa subunit (.1.2.3)
Lus10016452 166 / 1e-54 AT2G29540 131 / 9e-41 RNApolymerase 14 kDa subunit (.1.2.3)
Lus10019715 55 / 8e-10 AT3G08020 726 / 0.0 PHD finger family protein (.1)
Lus10016404 55 / 8e-10 AT3G08020 569 / 0.0 PHD finger family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0509 RBP11-like PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Representative CDS sequence
>Potri.001G246600.1 pacid=42789304 polypeptide=Potri.001G246600.1.p locus=Potri.001G246600 ID=Potri.001G246600.1.v4.1 annot-version=v4.1
ATGGAGCACGGTTCAGTGAGGGATCCAAGCAGCGCAACCTTCTGTTTTGTAGACGAAGATCATACTCTCGCAAACTCTGTCAGATTCGCCTTGAATCAAG
ATCCAAGGGTATCATTCTGTGGATACAGCATTCCTCATCCTTCTGATGCTAAGGTTAATATTCGAGTACAGACTACAGGTGATCCAGCTAGGGAGGTGTT
GAAGGATGCATGTCAGAATTTGATGGTGATGTGCCAGCACGTCAGGAGCACTTTGGACAAGGCTGTTGATGATTATAGAAGCAATCCCACAGATATGGAT
ACAAAATAA
AA sequence
>Potri.001G246600.1 pacid=42789304 polypeptide=Potri.001G246600.1.p locus=Potri.001G246600 ID=Potri.001G246600.1.v4.1 annot-version=v4.1
MEHGSVRDPSSATFCFVDEDHTLANSVRFALNQDPRVSFCGYSIPHPSDAKVNIRVQTTGDPAREVLKDACQNLMVMCQHVRSTLDKAVDDYRSNPTDMD
TK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G29540 ATRPAC14, ATRPC... RNApolymerase 14 kDa subunit (... Potri.001G246600 0 1 Pt-ATRPC14.1
AT1G76065 LYR family of Fe/S cluster bio... Potri.014G181400 11.83 0.7529
AT4G39520 GTP-binding protein-related (.... Potri.007G080900 13.19 0.7050
AT1G53000 AtCKS, KDSB CMP-KDO synthetase, Nucleotide... Potri.001G400900 18.00 0.6537
AT5G45660 unknown protein Potri.011G076600 20.34 0.7203
AT3G56250 unknown protein Potri.013G083700 32.18 0.7112
AT1G12400 Nucleotide excision repair, TF... Potri.009G138800 35.09 0.6733
AT4G21192 Cytochrome c oxidase biogenesi... Potri.004G227500 35.49 0.6921
AT5G27000 KATD, ATK4 KINESIN-LIKE PROTEIN IN ARABID... Potri.013G011500 42.16 0.7033
AT4G18060 SH3 domain-containing protein ... Potri.011G077500 43.72 0.7028
AT4G33140 Haloacid dehalogenase-like hyd... Potri.006G216500 50.19 0.6960

Potri.001G246600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.