Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07300 49 / 3e-08 josephin protein-related (.1) AT3G09032 38 / 0.0006 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G043501 [exp] 112 / 6e-33 AT1G07300 / josephin protein-related (.1) Potri.016G112700 [exp] 49 / 4e-08 AT5G01225 73 / 3e-17 unknown protein Potri.006G097700 [exp] 45 / 1e-06 AT3G09032 65 / 4e-14 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018215 [exp] 51 / 4e-09 ND / Lus10040690 [exp] 46 / 3e-07 ND / Lus10035520 [exp] 45 / 2e-06 AT3G09032 54 / 9e-10 unknown protein Lus10027777 [exp] 39 / 0.0004 AT3G09032 61 / 3e-12 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G249500.1 pacid=42788581 polypeptide=Potri.001G249500.1.p locus=Potri.001G249500 ID=Potri.001G249500.1.v4.1 annot-version=v4.1 ATGAAGAGACCAGCTGTGAACATGTCAGCAAGGATTAATCAAGTGAAATACAAACCTACTGGTATCAACCAGAACGCAATATCCATCAGGCGAAACTCTG GTAACAGAGTTTCTGGGAATAGATGGCTTGGTCGAAGTTATGGATTCAGGCTCCTGAAGAGATCAATAATGTCACCAGCGGTATTTCTCAAGCATCTCGG TGGGAAGGTAGCCAAAGCTCTGCGTTTAGAGAGGCGACCTTCACCTGGAGTTTCTTCTTCAGGAAGATCAAGACCATCTGTAGCTCCTATTGATGCTCAC AGAGCTGAAGCCATAGAAGATTGCATTGAGTTCATCAACTCTGCTTCTTTGTCCAGGTCAAATTCCGTTACTGCAAATCCTTGTTAA
AA sequence Show only first row Show all	>Potri.001G249500.1 pacid=42788581 polypeptide=Potri.001G249500.1.p locus=Potri.001G249500 ID=Potri.001G249500.1.v4.1 annot-version=v4.1 MKRPAVNMSARINQVKYKPTGINQNAISIRRNSGNRVSGNRWLGRSYGFRLLKRSIMSPAVFLKHLGGKVAKALRLERRPSPGVSSSGRSRPSVAPIDAH RAEAIEDCIEFINSASLSRSNSVTANPC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07300			josephin protein-related (.1)		Potri.001G249500 [exp]	0	1
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Potri.013G149000 [exp]	1.73	0.9113
AT1G76490		HMGR1, HMG1, At...	3-HYDROXY-3-METHYLGLUTARYL COA...		Potri.001G457000 [exp]	1.73	0.9222	Pt-HMGR3.1
AT4G34215			Domain of unknown function (DU...		Potri.009G096400 [exp]	3.74	0.8666
AT4G13440			Calcium-binding EF-hand family...		Potri.019G029100 [exp]	4.24	0.9154
					Potri.009G152101 [exp]	4.89	0.8854
AT5G35550	MYB	ATTT2, TT2, AtM...	TRANSPARENT TESTA 2, MYB DOMAI...		Potri.006G221500 [exp]	6.00	0.8628	MYB183
AT1G20190		ATHEXPALPHA1.14...	EXPANSIN 11, expansin 11 (.1)		Potri.005G244100 [exp]	7.93	0.8832	Pt-ATEXPA11.1,PtrEXPA18
AT3G03680			C2 calcium/lipid-binding plant...		Potri.013G066500 [exp]	8.12	0.8695
AT5G14920			Gibberellin-regulated family p...		Potri.001G350600 [exp]	10.48	0.8875
					Potri.001G388300 [exp]	11.31	0.8543

Compare expression of checked genes

Potri.001G249500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.