Potri.001G251204 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58740 299 / 9e-106 HSP20-like chaperones superfamily protein (.1)
AT4G27890 70 / 7e-15 HSP20-like chaperones superfamily protein (.1)
AT5G53400 69 / 3e-14 BOB1, BOBBER1 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G046000 113 / 2e-33 AT5G58740 97 / 2e-27 HSP20-like chaperones superfamily protein (.1)
Potri.015G013900 81 / 1e-18 AT5G53400 283 / 8e-95 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Potri.012G014100 77 / 1e-17 AT5G53400 277 / 4e-93 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Potri.003G100900 72 / 1e-15 AT5G53400 232 / 2e-75 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Potri.001G132500 71 / 2e-15 AT5G53400 225 / 1e-73 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018234 260 / 3e-90 AT5G58740 266 / 8e-93 HSP20-like chaperones superfamily protein (.1)
Lus10040670 208 / 4e-70 AT5G58740 216 / 2e-73 HSP20-like chaperones superfamily protein (.1)
Lus10019028 76 / 5e-17 AT5G53400 324 / 3e-111 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Lus10005009 73 / 1e-15 AT5G53400 306 / 2e-103 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Lus10018250 68 / 2e-14 AT5G53400 213 / 4e-69 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Lus10040656 67 / 3e-14 AT5G53400 216 / 3e-70 BOBBER1, HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF04969 CS CS domain
Representative CDS sequence
>Potri.001G251204.1 pacid=42788390 polypeptide=Potri.001G251204.1.p locus=Potri.001G251204 ID=Potri.001G251204.1.v4.1 annot-version=v4.1
ATGGCTGAGAAATTGGCTCCTGAGAAGCGTCACAGCTTCGTCCACGACGGTAAAACTATATTTGAGTGGGATCAAACCCTTGAAGAAGTAAATATTTACA
TAAATTTACCACCAAATGTTCACTCCAAGCAGTTTTACTGCAAGATTCAGTCCAAGCATGTTGAAGTTGGCATCAAAGGCAACCCTCCTTATCTCAACCA
TGACCTTACTTGCCCTGTCAAGACCGATTCTTCCTTCTGGACTTTAGAGGATGATATAATGCACATAACAATGCAAAAAAGGGACAAAGGTCAGACATGG
GCTTCACCGATATTGGGTGAGGGTCAACTCGATGCTTATTCCTCTGATCTTGAGCAGAAGCGACTTATGCTTCAGAGATTTCAGGAAGAGAACCCTGGCT
TTGACTTCTCACAGGCTCAATTCACAGGGAACTGCCCTGATCCAAGAACTTTTATGGGTGGTATCCGCAATGATTGA
AA sequence
>Potri.001G251204.1 pacid=42788390 polypeptide=Potri.001G251204.1.p locus=Potri.001G251204 ID=Potri.001G251204.1.v4.1 annot-version=v4.1
MAEKLAPEKRHSFVHDGKTIFEWDQTLEEVNIYINLPPNVHSKQFYCKIQSKHVEVGIKGNPPYLNHDLTCPVKTDSSFWTLEDDIMHITMQKRDKGQTW
ASPILGEGQLDAYSSDLEQKRLMLQRFQEENPGFDFSQAQFTGNCPDPRTFMGGIRND

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G58740 HSP20-like chaperones superfam... Potri.001G251204 0 1
AT3G10640 VPS60.1 SNF7 family protein (.1.2) Potri.008G018300 3.16 0.7297
AT5G37780 ACAM-1, TCH1, C... TOUCH 1, calmodulin 1 (.1.2.3) Potri.015G032600 4.47 0.6714 ACCAL.6
AT5G13190 AtGILP GSH-induced LITAF domain prote... Potri.003G165900 6.32 0.6759
AT2G24860 DnaJ/Hsp40 cysteine-rich domai... Potri.006G266800 15.96 0.6759
AT1G16180 Serinc-domain containing serin... Potri.003G186500 16.70 0.6087
AT1G73030 CHMP1A, VPS46.2 CHARGED MULTIVESICULAR BODY PR... Potri.003G045300 18.49 0.6270
AT1G61700 RNA polymerases N / 8 kDa subu... Potri.003G102900 22.84 0.5844
AT5G40670 PQ-loop repeat family protein ... Potri.017G070300 24.49 0.5982
AT1G55265 Protein of unknown function, D... Potri.001G008320 27.23 0.6222
AT2G20120 COV1 CONTINUOUS VASCULAR RING, Prot... Potri.006G158100 30.62 0.5916

Potri.001G251204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.