Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40116 83 / 3e-20 Phosphoinositide-specific phospholipase C family protein (.1) AT3G08510 82 / 1e-19 ATPLC2 phospholipase C 2 (.1.2.3) AT4G38530 79 / 1e-18 ATPLC1 phospholipase C1 (.1) AT5G58700 79 / 1e-18 ATPLC4 phosphatidylinositol-speciwc phospholipase C4 (.1.2) AT5G58670 78 / 2e-18 ATPLC1 phospholipase C 1, ARABIDOPSIS THALIANA PHOSPHOLIPASE C, phospholipase C1 (.1) AT3G55940 77 / 4e-18 Phosphoinositide-specific phospholipase C family protein (.1) AT5G58690 70 / 2e-15 ATPLC5 phosphatidylinositol-speciwc phospholipase C5 (.1) AT3G47290 64 / 2e-13 ATPLC8 phosphatidylinositol-speciwc phospholipase C8 (.1) AT3G47220 60 / 4e-12 ATPLC9 phosphatidylinositol-speciwc phospholipase C9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G046600 [exp] 102 / 4e-27 AT3G08510 557 / 0.0 phospholipase C 2 (.1.2.3) Potri.001G252300 [exp] 101 / 1e-26 AT3G08510 701 / 0.0 phospholipase C 2 (.1.2.3) Potri.010G188800 [exp] 89 / 4e-22 AT3G08510 869 / 0.0 phospholipase C 2 (.1.2.3) Potri.010G188900 [exp] 88 / 5e-22 AT2G40116 806 / 0.0 Phosphoinositide-specific phospholipase C family protein (.1) Potri.008G068400 [exp] 86 / 4e-21 AT3G08510 888 / 0.0 phospholipase C 2 (.1.2.3) Potri.008G068300 [exp] 85 / 9e-21 AT2G40116 823 / 0.0 Phosphoinositide-specific phospholipase C family protein (.1) Potri.001G252100 [exp] 82 / 6e-20 AT5G58700 791 / 0.0 phosphatidylinositol-speciwc phospholipase C4 (.1.2) Potri.003G145950 [exp] 39 / 0.0001 AT4G12560 113 / 7e-28 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009891 [exp] 92 / 4e-23 AT3G08510 849 / 0.0 phospholipase C 2 (.1.2.3) Lus10018241 [exp] 89 / 4e-22 AT5G58700 532 / 0.0 phosphatidylinositol-speciwc phospholipase C4 (.1.2) Lus10040664 [exp] 89 / 5e-22 AT5G58700 744 / 0.0 phosphatidylinositol-speciwc phospholipase C4 (.1.2) Lus10014845 [exp] 88 / 1e-21 AT3G08510 866 / 0.0 phospholipase C 2 (.1.2.3) Lus10028287 [exp] 86 / 3e-21 AT3G08510 840 / 0.0 phospholipase C 2 (.1.2.3) Lus10040199 [exp] 86 / 4e-21 AT3G08510 786 / 0.0 phospholipase C 2 (.1.2.3) Lus10036182 [exp] 82 / 7e-20 AT3G08510 669 / 0.0 phospholipase C 2 (.1.2.3) Lus10009894 [exp] 81 / 3e-19 AT2G40116 824 / 0.0 Phosphoinositide-specific phospholipase C family protein (.1) Lus10038319 [exp] 79 / 9e-19 AT3G08510 659 / 0.0 phospholipase C 2 (.1.2.3) Lus10018240 [exp] 46 / 4e-07 AT5G58700 473 / 1e-162 phosphatidylinositol-speciwc phospholipase C4 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G252104.1 pacid=42788727 polypeptide=Potri.001G252104.1.p locus=Potri.001G252104 ID=Potri.001G252104.1.v4.1 annot-version=v4.1 ATGTTTAGAGCCAACGGTGGCTGTGGTTGCGTGAAAAAACCTGGTTTTTCATTGAGTGAACCTGATTCTGATCCTAGTGTGCAATTGACTGTAGAAAAGA TTTTGAAGGTGAAAATCTACTTTGGGGCAGGGTGGCATTTGGATTTTCGCTGCACACATTTTGATCTGTATTCTCCACCTGACTTCTTCGCAAGAGATGT TCAGTGGGCCGTGAGATTAGTCGTGGTGCGCGCAAGCTGGCCCGGACACCCACGTAAATAA
AA sequence Show only first row Show all	>Potri.001G252104.1 pacid=42788727 polypeptide=Potri.001G252104.1.p locus=Potri.001G252104 ID=Potri.001G252104.1.v4.1 annot-version=v4.1 MFRANGGCGCVKKPGFSLSEPDSDPSVQLTVEKILKVKIYFGAGWHLDFRCTHFDLYSPPDFFARDVQWAVRLVVVRASWPGHPRK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G08510		ATPLC2	phospholipase C 2 (.1.2.3)		Potri.001G252104 [exp]	0	1
AT2G37530			unknown protein		Potri.006G083800 [exp]	12.24	0.7965
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.014G067900 [exp]	16.49	0.6483
AT1G47670			Transmembrane amino acid trans...		Potri.004G181000 [exp]	20.14	0.7609
AT4G39230			NmrA-like negative transcripti...		Potri.007G036500 [exp]	20.59	0.7899	PCBER5
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.007G111200 [exp]	23.02	0.7841
AT4G10490			2-oxoglutarate (2OG) and Fe(II...		Potri.014G106700 [exp]	27.45	0.7472
AT4G37280			MRG family protein (.1)		Potri.002G122500 [exp]	29.49	0.7472
					Potri.006G076350 [exp]	30.46	0.7472
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.019G078600 [exp]	33.58	0.7582
AT4G11410			NAD(P)-binding Rossmann-fold s...		Potri.003G128901 [exp]	34.07	0.7350

Compare expression of checked genes

Potri.001G252104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.