Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G51510 230 / 3e-77 Y14 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G54580 54 / 2e-09 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G37510 53 / 6e-09 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G61030 52 / 5e-08 GR-RBP3 glycine-rich RNA-binding protein 3 (.1) AT1G73530 50 / 8e-08 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G18630 50 / 9e-08 GR-RBP6 glycine-rich RNA-binding protein 6 (.1) AT3G11400 50 / 3e-07 ATEIF3G1, EIF3G1 eukaryotic translation initiation factor 3G1 (.1.2) AT1G16610 50 / 4e-07 RNPS1, SR45 arginine/serine-rich 45 (.1.2.3) AT5G64200 48 / 1e-06 ATSC35, At-SC35 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) AT4G27000 48 / 2e-06 ATRBP45C RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G051000 [exp] 330 / 1e-116 AT1G51510 248 / 2e-84 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G048300 [exp] 130 / 3e-38 AT1G51510 134 / 1e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.011G130300 [exp] 56 / 9e-10 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G409800 [exp] 55 / 1e-09 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.015G057400 [exp] 52 / 4e-08 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.011G143100 [exp] 52 / 6e-08 AT1G16610 169 / 3e-48 arginine/serine-rich 45 (.1.2.3) Potri.012G061600 [exp] 52 / 6e-08 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.001G319900 [exp] 50 / 7e-08 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.010G199000 [exp] 51 / 1e-07 AT3G11400 422 / 4e-150 eukaryotic translation initiation factor 3G1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009963 [exp] 271 / 7e-93 AT1G51510 265 / 3e-90 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003632 [exp] 271 / 2e-92 AT1G51510 260 / 3e-88 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003593 [exp] 60 / 2e-10 AT5G54580 174 / 6e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014802 [exp] 57 / 1e-09 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023758 [exp] 56 / 1e-09 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003980 [exp] 54 / 6e-09 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10031786 [exp] 55 / 8e-09 AT1G16610 207 / 7e-63 arginine/serine-rich 45 (.1.2.3) Lus10017852 [exp] 54 / 8e-09 AT5G61030 178 / 7e-55 glycine-rich RNA-binding protein 3 (.1) Lus10031212 [exp] 54 / 1e-08 AT1G16610 210 / 6e-64 arginine/serine-rich 45 (.1.2.3) Lus10034685 [exp] 54 / 2e-08 AT5G61030 177 / 7e-54 glycine-rich RNA-binding protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.001G255600.2 pacid=42789725 polypeptide=Potri.001G255600.2.p locus=Potri.001G255600 ID=Potri.001G255600.2.v4.1 annot-version=v4.1 ATGGCAAACACGGAGGCCGAAGCGGTGGATTTTGAGCCAGAGGAAGATGATTTGATGGACGAAGACGGTGCCGCCGACGCTGACGCCTCCTCCTCACCTC GTGCTCCACTCCCCAAGTTAAAGTCAGCTATTACTGGAGGCAGCGCGTCTTCTTCACTCTCCGCTCCTAAAAAGACTAAAGGCCGTGGGTTTAGAGAAGA GGTTGATGCTGAGAGACAGAGCCGCCTCTCTGGTCGTGGATTTGATTCCCTCGGTTCTGATGGTGGGCCTGGCCCCCAGCGATCTGTTGAAGGATGGATA ATTTTGGTGAGTGGAGTGCATGAGGAAGCACAAGATGATCATCTGCAAGAAGCTTTCGGTGAATTTGGGGAAATAAAAAATTTGCATTTGAATCTTGATC GCCGCACTGGTTTTGTTAAGGGCTACGCGCTGATAGAATATGAGAAGTTTGAGCAAGCAGAGAATGCAATAGCTTCAATGAATGGGGGAACATTGCTCGA ACAGATTATCTATGTTGATTGGGCCTTCAGCAATGGCCCCAGCAATTGGGCCTCCAGAAGAAAGAACATGAGACCTGAACGAACGAATCGCTCAAGGAGT CCTAGGAGGAGATATTAA
AA sequence Show only first row Show all	>Potri.001G255600.2 pacid=42789725 polypeptide=Potri.001G255600.2.p locus=Potri.001G255600 ID=Potri.001G255600.2.v4.1 annot-version=v4.1 MANTEAEAVDFEPEEDDLMDEDGAADADASSSPRAPLPKLKSAITGGSASSSLSAPKKTKGRGFREEVDAERQSRLSGRGFDSLGSDGGPGPQRSVEGWI ILVSGVHEEAQDDHLQEAFGEFGEIKNLHLNLDRRTGFVKGYALIEYEKFEQAENAIASMNGGTLLEQIIYVDWAFSNGPSNWASRRKNMRPERTNRSRS PRRRY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G51510		Y14	RNA-binding (RRM/RBD/RNP motif...		Potri.001G255600 [exp]	0	1
AT4G38710			glycine-rich protein (.1.2)		Potri.004G169100 [exp]	5.47	0.7002
AT3G13230			RNA-binding KH domain-containi...		Potri.001G469200 [exp]	5.83	0.7367
AT5G16790		AtTHO7	Tho complex subunit 7/Mft1p (....		Potri.013G082900 [exp]	9.89	0.7040
AT1G07210			Ribosomal protein S18 (.1)		Potri.006G170500 [exp]	13.63	0.7072
AT1G09760		U2A'	U2 small nuclear ribonucleopro...		Potri.003G158800 [exp]	14.96	0.7087
AT3G13882			Ribosomal protein L34 (.1.2)		Potri.003G041100 [exp]	17.46	0.7086
AT3G55820			Fasciclin-like arabinogalactan...		Potri.010G192300 [exp]	17.74	0.6599
AT2G27960		CKS1AT, CKS1	cyclin-dependent kinase-subuni...		Potri.009G004000 [exp]	17.88	0.6849
AT3G59650			mitochondrial ribosomal protei...		Potri.013G126200 [exp]	18.00	0.7099
AT3G49910			Translation protein SH3-like f...		Potri.005G082600 [exp]	22.97	0.7136	Pt-RPL26.1

Compare expression of checked genes

Potri.001G255600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.