Potri.001G255904 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G024400 76 / 2e-17 AT5G10250 331 / 5e-106 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015169 43 / 5e-06 AT5G64330 264 / 7e-79 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.001G255904.1 pacid=42788874 polypeptide=Potri.001G255904.1.p locus=Potri.001G255904 ID=Potri.001G255904.1.v4.1 annot-version=v4.1
ATGGCTAGCATGGGAAGTAGAAGTCTTGACAGTGGAAATGCTATTCTATCTAGTAGAAAGCATAACAAGTGTGTTTTTCTTCCAGCTGATGCGAATATGG
TTGCCGAATCACTTGAAAGACGAAATCAGAACTGGGAATTTTCACCTGGAAAGAAAAATGATACTGTTGGATTTCGCAGTTCAGACTACATACTGGAAAT
TAGGCTCATGATTACAGCCGGCAACATTCTCGTGAGAATTCAACTTTAA
AA sequence
>Potri.001G255904.1 pacid=42788874 polypeptide=Potri.001G255904.1.p locus=Potri.001G255904 ID=Potri.001G255904.1.v4.1 annot-version=v4.1
MASMGSRSLDSGNAILSSRKHNKCVFLPADANMVAESLERRNQNWEFSPGKKNDTVGFRSSDYILEIRLMITAGNILVRIQL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G255904 0 1
AT3G21090 ABCG15 ATP-binding cassette G15, ABC-... Potri.001G255900 5.65 0.9424
AT4G10590 UBP10 ubiquitin-specific protease 10... Potri.016G067400 10.48 0.9259
AT4G34135 UGT73B2 UDP-glucosyltransferase 73B2 (... Potri.005G008050 10.86 0.9202
AT1G12300 Tetratricopeptide repeat (TPR)... Potri.019G062266 12.00 0.9314
AT5G42120 Concanavalin A-like lectin pro... Potri.005G189500 12.96 0.9356
AT4G34135 UGT73B2 UDP-glucosyltransferase 73B2 (... Potri.005G010016 13.67 0.9613
AT4G05320 UBQ10 polyubiquitin 10 (.1.2.3.4.5.6... Potri.001G263000 13.85 0.9578 Pt-UBQ11.1
AT3G61420 BSD domain (BTF2-like transcri... Potri.005G061366 14.89 0.9081
AT1G30760 FAD-binding Berberine family p... Potri.011G161400 16.43 0.8981
AT3G11310 unknown protein Potri.010G022201 18.97 0.9632

Potri.001G255904 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.