Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64330 94 / 8e-24 JK218, RPT3, NPH3 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) AT3G50840 81 / 3e-19 Phototropic-responsive NPH3 family protein (.1) AT5G10250 80 / 6e-19 DOT3 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1) AT5G66560 79 / 1e-18 Phototropic-responsive NPH3 family protein (.1) AT5G03250 77 / 7e-18 Phototropic-responsive NPH3 family protein (.1) AT2G30520 75 / 3e-17 RPT2 ROOT PHOTOTROPISM 2, Phototropic-responsive NPH3 family protein (.1.2.3) AT1G30440 74 / 5e-17 Phototropic-responsive NPH3 family protein (.1) AT5G48800 73 / 1e-16 Phototropic-responsive NPH3 family protein (.1) AT4G31820 71 / 1e-15 MAB4, ENP, NPY1 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) AT3G44820 71 / 1e-15 Phototropic-responsive NPH3 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G024400 [exp] 160 / 3e-48 AT5G10250 331 / 5e-106 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1) Potri.005G075400 [exp] 100 / 6e-26 AT5G10250 695 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1) Potri.017G048200 [exp] 97 / 4e-25 AT5G64330 993 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Potri.007G112600 [exp] 97 / 6e-25 AT5G64330 989 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Potri.007G093000 [exp] 94 / 9e-24 AT5G10250 706 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1) Potri.005G130700 [exp] 81 / 2e-19 AT5G66560 733 / 0.0 Phototropic-responsive NPH3 family protein (.1) Potri.007G033900 [exp] 81 / 3e-19 AT5G66560 789 / 0.0 Phototropic-responsive NPH3 family protein (.1) Potri.007G053200 [exp] 74 / 7e-17 AT5G67385 807 / 0.0 Phototropic-responsive NPH3 family protein (.1) Potri.008G038600 [exp] 73 / 1e-16 AT5G03250 723 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015169 [exp] 100 / 3e-26 AT5G64330 264 / 7e-79 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Lus10040484 [exp] 94 / 9e-24 AT5G64330 440 / 5e-150 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Lus10011290 [exp] 92 / 3e-23 AT5G64330 438 / 3e-149 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Lus10014337 [exp] 91 / 1e-22 AT5G10250 620 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1) Lus10026046 [exp] 90 / 2e-22 AT5G10250 639 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1) Lus10041276 [exp] 78 / 3e-18 AT5G66560 750 / 0.0 Phototropic-responsive NPH3 family protein (.1) Lus10019522 [exp] 77 / 1e-17 AT3G44820 781 / 0.0 Phototropic-responsive NPH3 family protein (.1) Lus10039099 [exp] 75 / 3e-17 AT5G47800 655 / 0.0 Phototropic-responsive NPH3 family protein (.1) Lus10037432 [exp] 75 / 5e-17 AT5G66560 747 / 0.0 Phototropic-responsive NPH3 family protein (.1) Lus10019290 [exp] 73 / 1e-16 AT5G67385 402 / 6e-135 Phototropic-responsive NPH3 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0033 [poplar] [flax] POZ PF00651 [poplar] [flax] BTB BTB/POZ domain
Representative CDS sequence Show only first row Show all	>Potri.001G255950.1 pacid=42788940 polypeptide=Potri.001G255950.1.p locus=Potri.001G255950 ID=Potri.001G255950.1.v4.1 annot-version=v4.1 ATGATCTCAAGAAGTGAATATTTGAATAGATTAGTATTCCAGAGAAGAAGTAATGGAGGAAAGGGTACCTTCCCCAAGATTCAATTACACAATTTTCCAG TTGGATCTGAAATCTTTGAGATAGCAGTGAAGTTCTGCTATGGATGGAAGGTTGATCTAACAGCATCCAACATTGCTCCTGTACACTGTGCTGCACGTTT CTTGGAAATGAGCAATTATCTCGAACAAGGAAATCTAATTTCCAAAACAGAGGCTTTTATAAGTTTTGTATTGTTATGA
AA sequence Show only first row Show all	>Potri.001G255950.1 pacid=42788940 polypeptide=Potri.001G255950.1.p locus=Potri.001G255950 ID=Potri.001G255950.1.v4.1 annot-version=v4.1 MISRSEYLNRLVFQRRSNGGKGTFPKIQLHNFPVGSEIFEIAVKFCYGWKVDLTASNIAPVHCAARFLEMSNYLEQGNLISKTEAFISFVLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Potri.001G255950 [exp]	0	1
AT5G01030			Protein of unknown function (D...		Potri.016G105500 [exp]	4.89	0.9749
AT5G05800			unknown protein		Potri.007G118701 [exp]	7.93	0.9750
					Potri.017G115002 [exp]	12.24	0.9271
					Potri.013G071200 [exp]	12.36	0.9745
AT3G24255			RNA-directed DNA polymerase (r...		Potri.006G175124 [exp]	13.71	0.9489
AT1G48780			unknown protein		Potri.012G055300 [exp]	16.70	0.9489
AT1G02090		ATCSN7, COP15, ...	FUSCA 5, CONSTITUTIVE PHOTOMOR...		Potri.003G081066 [exp]	18.16	0.9734
					Potri.013G011550 [exp]	18.97	0.9621
					Potri.004G011901 [exp]	20.19	0.9057
AT1G21280			unknown protein		Potri.001G247404 [exp]	22.62	0.9363

Compare expression of checked genes

Potri.001G255950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.