Potri.001G260300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43210 132 / 8e-40 Excinuclease ABC, C subunit, N-terminal (.1)
AT2G30350 55 / 2e-09 Excinuclease ABC, C subunit, N-terminal (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G259216 183 / 1e-59 AT5G43210 168 / 1e-53 Excinuclease ABC, C subunit, N-terminal (.1)
Potri.001G259900 183 / 1e-59 AT5G43210 168 / 1e-53 Excinuclease ABC, C subunit, N-terminal (.1)
Potri.001G260600 175 / 7e-56 AT5G43210 165 / 7e-52 Excinuclease ABC, C subunit, N-terminal (.1)
Potri.019G127600 51 / 7e-08 AT2G30350 269 / 5e-85 Excinuclease ABC, C subunit, N-terminal (.1.2)
Potri.013G155900 51 / 7e-08 AT2G30350 268 / 4e-85 Excinuclease ABC, C subunit, N-terminal (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016370 99 / 7e-26 AT5G43210 107 / 8e-29 Excinuclease ABC, C subunit, N-terminal (.1)
Lus10042228 50 / 1e-07 AT2G30350 257 / 9e-83 Excinuclease ABC, C subunit, N-terminal (.1.2)
Lus10024187 50 / 2e-07 AT2G30350 268 / 1e-86 Excinuclease ABC, C subunit, N-terminal (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0418 GIY-YIG PF01541 GIY-YIG GIY-YIG catalytic domain
Representative CDS sequence
>Potri.001G260300.1 pacid=42790577 polypeptide=Potri.001G260300.1.p locus=Potri.001G260300 ID=Potri.001G260300.1.v4.1 annot-version=v4.1
ATGAAGCCAGTAAAGCAGCACCTATGGTCCATAACGGTTGGTCCGTTGACGTTCCGGTCTGTAAAACTTAAAGCATCCTCATCAAAACCACCACCACCAC
AACAACAACAACCATCCTCATCCTCATCATTGCCCCGATCAAGAAAAACACGAGCAAAATCGAGCTCAAATTCGAAATCGAGATCATGGTCTGTGTATCT
TATTCTCTCTACCAACCACCCGATCAAGACTTACGTTGGTGTCACCACCAATTTCTCTCGCCGCTTGAAACAACATAATGGCAAGCTTAAAGGAGGTGCA
AAAGCATCCCGTGCAGGAAGGCCGTGGATTTGTGCTTGCATAATTCGCGGTTTTAATGACCGAAGTGAAGCTTGCAAGTTTGAATCAAAATGGAAAAGCT
TTTCAAGGAAATTTCCTCGAAAAAGGATAGATGATGACCAGATGAAGCTAGAGCAGGAAGGACTCGCACCGACTCCTGCAACATAG
AA sequence
>Potri.001G260300.1 pacid=42790577 polypeptide=Potri.001G260300.1.p locus=Potri.001G260300 ID=Potri.001G260300.1.v4.1 annot-version=v4.1
MKPVKQHLWSITVGPLTFRSVKLKASSSKPPPPQQQQPSSSSSLPRSRKTRAKSSSNSKSRSWSVYLILSTNHPIKTYVGVTTNFSRRLKQHNGKLKGGA
KASRAGRPWICACIIRGFNDRSEACKFESKWKSFSRKFPRKRIDDDQMKLEQEGLAPTPAT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G43210 Excinuclease ABC, C subunit, N... Potri.001G260300 0 1
AT5G43210 Excinuclease ABC, C subunit, N... Potri.001G259216 2.44 0.7963
AT5G43210 Excinuclease ABC, C subunit, N... Potri.001G259900 7.48 0.7481
AT5G64090 unknown protein Potri.001G209800 9.48 0.7867
AT4G02425 unknown protein Potri.014G129500 9.94 0.7759
AT5G43210 Excinuclease ABC, C subunit, N... Potri.001G260600 10.39 0.8243
AT1G75390 bZIP ATBZIP44 basic leucine-zipper 44 (.1.2) Potri.002G031900 28.98 0.7543 GBF5.2
AT4G11740 SAY1 Ubiquitin-like superfamily pro... Potri.001G109500 30.59 0.7530
AT1G09710 MYB Homeodomain-like superfamily p... Potri.002G106500 33.10 0.7954
AT4G31170 Protein kinase superfamily pro... Potri.006G280000 33.36 0.7806
AT5G05380 PRA1.B3 prenylated RAB acceptor 1.B3 (... Potri.019G124100 40.69 0.7242

Potri.001G260300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.