Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63470 236 / 2e-75 SCPL40 serine carboxypeptidase-like 40 (.1) AT4G30610 174 / 8e-52 SCPL24, BRS1 SERINE CARBOXYPEPTIDASE 24 PRECURSOR, BRI1 SUPPRESSOR 1, alpha/beta-Hydrolases superfamily protein (.1) AT2G05850 172 / 4e-51 SCPL38 serine carboxypeptidase-like 38 (.1) AT5G08260 170 / 3e-50 SCPL35 serine carboxypeptidase-like 35 (.1) AT3G52000 169 / 7e-50 SCPL36 serine carboxypeptidase-like 36 (.1) AT2G24000 165 / 6e-49 SCPL22 serine carboxypeptidase-like 22 (.1.2) AT2G24010 165 / 1e-48 SCPL23 serine carboxypeptidase-like 23 (.1) AT5G23210 159 / 1e-46 SCPL34 serine carboxypeptidase-like 34 (.1.2.3.4) AT3G02110 157 / 1e-45 SCPL25 serine carboxypeptidase-like 25 (.1) AT3G52010 157 / 2e-45 SCPL37 serine carboxypeptidase-like 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G056000 [exp] 323 / 2e-109 AT3G63470 557 / 0.0 serine carboxypeptidase-like 40 (.1) Potri.009G055900 [exp] 286 / 5e-95 AT3G63470 570 / 0.0 serine carboxypeptidase-like 40 (.1) Potri.001G261100 [exp] 273 / 6e-90 AT3G63470 611 / 0.0 serine carboxypeptidase-like 40 (.1) Potri.018G105700 [exp] 173 / 1e-51 AT4G30610 710 / 0.0 SERINE CARBOXYPEPTIDASE 24 PRECURSOR, BRI1 SUPPRESSOR 1, alpha/beta-Hydrolases superfamily protein (.1) Potri.006G183200 [exp] 170 / 2e-50 AT4G30610 739 / 0.0 SERINE CARBOXYPEPTIDASE 24 PRECURSOR, BRI1 SUPPRESSOR 1, alpha/beta-Hydrolases superfamily protein (.1) Potri.007G072300 [exp] 167 / 4e-49 AT5G08260 632 / 0.0 serine carboxypeptidase-like 35 (.1) Potri.004G120100 [exp] 166 / 1e-48 AT3G02110 755 / 0.0 serine carboxypeptidase-like 25 (.1) Potri.017G094100 [exp] 163 / 7e-48 AT3G02110 758 / 0.0 serine carboxypeptidase-like 25 (.1) Potri.005G091700 [exp] 160 / 2e-46 AT5G23210 652 / 0.0 serine carboxypeptidase-like 34 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019747 [exp] 185 / 9e-56 AT3G63470 502 / 4e-175 serine carboxypeptidase-like 40 (.1) Lus10016377 [exp] 182 / 9e-55 AT3G63470 501 / 2e-174 serine carboxypeptidase-like 40 (.1) Lus10039582 [exp] 176 / 3e-51 AT3G52020 372 / 1e-121 serine carboxypeptidase-like 39 (.1) Lus10005327 [exp] 166 / 2e-48 AT3G63470 449 / 1e-154 serine carboxypeptidase-like 40 (.1) Lus10019954 [exp] 164 / 5e-48 AT4G30610 720 / 0.0 SERINE CARBOXYPEPTIDASE 24 PRECURSOR, BRI1 SUPPRESSOR 1, alpha/beta-Hydrolases superfamily protein (.1) Lus10015489 [exp] 162 / 3e-47 AT4G30610 726 / 0.0 SERINE CARBOXYPEPTIDASE 24 PRECURSOR, BRI1 SUPPRESSOR 1, alpha/beta-Hydrolases superfamily protein (.1) Lus10015382 [exp] 160 / 3e-46 AT3G02110 731 / 0.0 serine carboxypeptidase-like 25 (.1) Lus10019748 [exp] 160 / 6e-46 AT3G63470 471 / 2e-161 serine carboxypeptidase-like 40 (.1) Lus10019749 [exp] 158 / 1e-45 AT3G63470 478 / 1e-165 serine carboxypeptidase-like 40 (.1) Lus10010190 [exp] 156 / 6e-45 AT5G23210 647 / 0.0 serine carboxypeptidase-like 34 (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [poplar] [flax] AB_hydrolase PF00450 [poplar] [flax] Peptidase_S10 Serine carboxypeptidase
Representative CDS sequence Show only first row Show all	>Potri.001G261201.1 pacid=42788449 polypeptide=Potri.001G261201.1.p locus=Potri.001G261201 ID=Potri.001G261201.1.v4.1 annot-version=v4.1 ATGTATGACTTCTTTGGAACCCATGCTCTAATTTCATATGACAACTTGCGTAAAATCCGACGTTACTGTGATTTCTCAAGAGCCCATGAATCTGCCGAGT GTCGTCATAGCTTGTTGAAAACAGATGCAGATGTTTGGAATGCTATTGATGTTTACAACATCTATGGTCCCTTGTGCCTTGACGGAAATCTCACATCGAG GCCCAGGAAGACTTCATTGATGAACTTCGATCCCTGCAGTGATTATTACGTGTATGCATACCTTAATCGACCTGACGTCCAAGAAGCCATGCATGCCAAT GTCACCAAGCTCACTTATGATTGGGAACCATGCGGCGATTTCAACTGGGTTGATAGTGCCTCTACCATTCTTCCCTTGCTAAAGGAGTTGATGGAAAATG GACTTCGAGTATGGTTATTCAGTGGTGATACAGACGGAAGGGTACCTTTCACTTCTACCCAGTATGCAATTAACAAGATGAAACTTCCTATCAAAACTGA ATGGTATCCATGGTTCTACGGTGGAGAGGTTGGTGGGTATGTACAAGTATACAAAGGGGACTTGACATTCGCAACTGTAAGAGGGGCTGGACATATGGTA CCAAGCATCCAGCCTGTGAGAGCATCTGCATTGATCAGTCACACCTCTTCCATAGCCAATGCCGAAGTCTAG
AA sequence Show only first row Show all	>Potri.001G261201.1 pacid=42788449 polypeptide=Potri.001G261201.1.p locus=Potri.001G261201 ID=Potri.001G261201.1.v4.1 annot-version=v4.1 MYDFFGTHALISYDNLRKIRRYCDFSRAHESAECRHSLLKTDADVWNAIDVYNIYGPLCLDGNLTSRPRKTSLMNFDPCSDYYVYAYLNRPDVQEAMHAN VTKLTYDWEPCGDFNWVDSASTILPLLKELMENGLRVWLFSGDTDGRVPFTSTQYAINKMKLPIKTEWYPWFYGGEVGGYVQVYKGDLTFATVRGAGHMV PSIQPVRASALISHTSSIANAEV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G63470		SCPL40	serine carboxypeptidase-like 4...		Potri.001G261201 [exp]	0	1
AT3G63088		RTFL14, DVL14	DEVIL 14, ROTUNDIFOLIA like 14...		Potri.008G202000 [exp]	2.00	0.8635
					Potri.001G062301 [exp]	4.00	0.8484
					Potri.005G161366 [exp]	8.30	0.8420
AT5G20240	MADS	PI, PISTILLATA	PISTILLATA, K-box region and M...		Potri.005G182200 [exp]	8.36	0.8589	Pt-MADS2.2
AT1G80760		NLM7, NIP6;1	NOD26-like intrinsic protein 6...		Potri.003G180900 [exp]	15.29	0.8811	Pt-NIP6.2
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Potri.007G117302 [exp]	21.09	0.8623
AT5G58960		GIL1	GRAVITROPIC IN THE LIGHT, Plan...		Potri.009G041000 [exp]	35.79	0.8213
					Potri.003G004301 [exp]	54.47	0.8218
AT1G58110	bZIP		Basic-leucine zipper (bZIP) tr...		Potri.015G147800 [exp]	84.72	0.8110
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G073566 [exp]	99.97	0.8264

Compare expression of checked genes

Potri.001G261201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.